1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-27
  5. IL-27 Protein, Mouse (HEK293, C-His)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling.IL-27 Protein, Mouse (HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling.IL-27 Protein, Mouse (HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide.

Background

IL-12, in association with IL23A, forms the IL-23 interleukin, a heterodimeric cytokine that plays essential roles in innate and adaptive immunity. This cytokine is implicated in the acute response to infection in peripheral tissues and binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade. IL-23 stimulates memory T-cells rather than naive T-cells and promotes the production of pro-inflammatory cytokines. It has been identified as a contributor to autoimmune inflammation, potentially responsible for autoimmune inflammatory diseases and implicated in tumorigenesis. Additionally, IL-12 functions as a growth factor for activated T and NK cells, enhancing the lytic activity of NK/lymphokine-activated killer cells, and stimulating interferon-gamma production by resting PBMC.

Biological Activity

Measured in a cell proliferation assay using TF-1 Human Erythroleukemia Cells. The ED50 this effect is 52.01 ng/ml, corresponding to a specific activity is 1.923×10^4 units/mg.

  • Measured in a cell proliferation assay using TF-1 Human Erythroleukemia Cells. The ED50 for this effect is 52.01 ng/ml, corresponding to a specific activity is 1.923×104 units/mg.
Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

O35228 (Y19-P228) & GSGSGGSGGSGSGKL & Q8K3I6 (F29-S234)

Gene ID

50498&246779

Synonyms
Interleukin-27 subunit beta; IL-27B; Ebi3; Interleukin-27 subunit alpha; IL-27A; p28
AA Sequence

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Weight

Approximately 57.6 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-27 Protein, Mouse (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-27 Protein, Mouse (HEK293, C-His)
Cat. No.:
HY-P73200A
Quantity:
MCE Japan Authorized Agent: