1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-27
  5. IL-27 Protein, Mouse (HEK293, His, solution)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling. IL-27 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived IL-27, expressed by HEK293 , with C-10*His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling. IL-27 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived IL-27, expressed by HEK293 , with C-10*His labeled tag. ,

Background

IL-12, in association with IL23A, forms the IL-23 interleukin, a heterodimeric cytokine that plays essential roles in innate and adaptive immunity. This cytokine is implicated in the acute response to infection in peripheral tissues and binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade. IL-23 stimulates memory T-cells rather than naive T-cells and promotes the production of pro-inflammatory cytokines. It has been identified as a contributor to autoimmune inflammation, potentially responsible for autoimmune inflammatory diseases and implicated in tumorigenesis. Additionally, IL-12 functions as a growth factor for activated T and NK cells, enhancing the lytic activity of NK/lymphokine-activated killer cells, and stimulating interferon-gamma production by resting PBMC.

Biological Activity

1.Measured by its binding ability in a functional ELISA. Immobilized mouse IL27-His at 10 μg/mL (100 μl/well) can bind human IL27RA-Fc and the EC50 is 0.26-0.62 μg/mL.
2.Measured in antiviral assay using HepG2 cells infected with vesicular stomatitisvirus (VSV) and the ED50 is ≤10ng/mL.

Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

O35228 (Y19-P228) &GSGSGGSGGSGSGKL& Q8K3I6 (F29-S234)

Gene ID

50498&246779

Synonyms
Interleukin-27 subunit beta; IL-27B; Ebi3; Interleukin-27 subunit alpha; IL-27A; p28
AA Sequence

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Weight

Approximately 60 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

IL-27 Protein, Mouse (HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-27 Protein, Mouse (HEK293, His, solution)
Cat. No.:
HY-P73200Y
Quantity:
MCE Japan Authorized Agent: