1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-7
  5. IL-7 Protein, Rat (His)

IL-7 Protein regulates T-cell and B-cell development, expansion, and survival, maintaining lymphoid homeostasis. Its interaction with IL7R and CSF2RG receptors is crucial in mediating these effects. IL-7 Protein, Rat is the recombinant rat-derived IL-7 protein, expressed by E. coli , with His tagged. .

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-7 Protein regulates T-cell and B-cell development, expansion, and survival, maintaining lymphoid homeostasis. Its interaction with IL7R and CSF2RG receptors is crucial in mediating these effects. IL-7 Protein, Rat is the recombinant rat-derived IL-7 protein, expressed by E. coli , with His tagged. .

Background

IL-7 Protein is a crucial hematopoietic cytokine that regulates the development, expansion, and survival of both naive and memory T-cells and B-cells, thereby controlling the population of mature lymphocytes and ensuring lymphoid homeostasis. Its interaction with IL7R and CSF2RG receptors plays a significant role in mediating these effects.

Biological Activity

Measured in a cell proliferation assay using HT-2 mouse T lymphocyte cells. The ED50 for this effect is 0.5105 ng/mL, corresponding to a specific activity is 1.959×106 units/mg.

  • Measured in a cell proliferation assay using HT-2 mouse T lymphocyte cells. The ED50 for this effect is 0.5105 ng/mL, corresponding to a specific activity is 1.959×106 units/mg.
Species

Rat

Source

E. coli

Tag

N-6*His

Accession

NP_037242 (D26-I154)

Gene ID

25647

Molecular Construction
N-term
6His
IL-7 (D26-I154)
Accession # NP_037242
C-term
Synonyms
Interleukin 7; Lymphopoietin-1; PBGF
AA Sequence

DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILNSSI

Molecular Weight

Approximately 18 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-7 Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-7 Protein, Rat (His)
Cat. No.:
HY-P73227A
Quantity:
MCE Japan Authorized Agent: