Irisin Protein, Human/Mouse/Rat (HEK293, Fc)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, Fc) is the recombinant human-derived Irisin protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Irisin Protein, Human/Mouse/Rat (HEK293, Fc) is 112 a.a., with molecular weight of 42-60 kDa.

Irisin is a hormone found to be derived from the fibronectin type III domain (FNDC5) gene, which is primarily released from skeletal muscle following exercise or exposure to cold. Irisin is primarily secreted by muscle and increases with exercise. In particular, irisin has been shown to have beneficial effects on adipose tissue, brain, and bone^[1]. Recombinant human/mouse/rat irisin protein (20-200 ng/ml; 24 h) had no effect on E-selectin expression at low concentrations. When HUVECs were treated with high concentrations of irisin (200 ng/ml), soluble E-selectin concentrations were similar to levels detected in controls treated with regular growth medium^[2].

1.Measured by its ability to inhibit proliferation of A549 cells. The IC₅₀ for this effect is 0.651 ng/mL, corresponding to a specific activity is 1.5361×10⁶ units/mg.
2.Measured by its ability to induce p38 MAPK activation in 3T3-L1 mouse embryonic fibroblast adipose-like cells. 1 μg/mL of Recombinant Human Irisin can effectively induce p38 MAPK activation.

• 
  Measured by its ability to inhibit proliferation of A549 cells. The IC₅₀ for this effect is 0.651 ng/mL, corresponding to a specific activity is 1.5361×10⁶ units/mg.

Human

HEK293

C-hFc

Q8NAU1-1 (D32-E143)

252995  [NCBI]

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Approximately 42-60 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.  [Content Brief]

  [2]. Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.  [Content Brief]