KIR2DS1 Protein, Human (P.pastoris, His)

KIR2DS1, on NK cells, acts as a receptor for specific HLA-C alleles, like w6, without inhibiting NK cell activity. Interacting with the adapter protein TYROBP/DAP12, their collaboration enhances KIR2DS1 stability at the cell surface. This dynamic interplay highlights the intricate regulatory mechanisms associated with KIR2DS1, contributing to the modulation of NK cell responses. KIR2DS1 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of KIR2DS1 Protein, Human (P.pastoris, His) is 224 a.a., with molecular weight of ~34 kDa.

KIR2DS1, situated on natural killer (NK) cells, functions as a receptor for specific HLA-C alleles, including w6, without exerting inhibitory effects on NK cell activity. This receptor engages with the adapter protein TYROBP/DAP12, and their interaction enhances the stability of KIR2DS1 at the cell surface. This intricate interplay underscores the dynamic regulatory mechanisms associated with KIR2DS1, contributing to the modulation of NK cell responses.

Human

P. pastoris

N-6*His

Q14954 (H22-H245)

3806  [NCBI]

HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Approximately 34 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.