1. Recombinant Proteins
  2. Receptor Proteins
  3. Killer-Cell Immunoglobulin-like Receptors
  4. KIR2DS1
  5. KIR2DS1 Protein, Human (P.pastoris, His)

KIR2DS1, on NK cells, acts as a receptor for specific HLA-C alleles, like w6, without inhibiting NK cell activity. Interacting with the adapter protein TYROBP/DAP12, their collaboration enhances KIR2DS1 stability at the cell surface. This dynamic interplay highlights the intricate regulatory mechanisms associated with KIR2DS1, contributing to the modulation of NK cell responses. KIR2DS1 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of KIR2DS1 Protein, Human (P.pastoris, His) is 224 a.a., with molecular weight of ~34 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KIR2DS1, on NK cells, acts as a receptor for specific HLA-C alleles, like w6, without inhibiting NK cell activity. Interacting with the adapter protein TYROBP/DAP12, their collaboration enhances KIR2DS1 stability at the cell surface. This dynamic interplay highlights the intricate regulatory mechanisms associated with KIR2DS1, contributing to the modulation of NK cell responses. KIR2DS1 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of KIR2DS1 Protein, Human (P.pastoris, His) is 224 a.a., with molecular weight of ~34 kDa.

Background

KIR2DS1, situated on natural killer (NK) cells, functions as a receptor for specific HLA-C alleles, including w6, without exerting inhibitory effects on NK cell activity. This receptor engages with the adapter protein TYROBP/DAP12, and their interaction enhances the stability of KIR2DS1 at the cell surface. This intricate interplay underscores the dynamic regulatory mechanisms associated with KIR2DS1, contributing to the modulation of NK cell responses.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

Q14954 (H22-H245)

Gene ID
Molecular Construction
N-term
6*His
KIR2DS1 (H22-H245)
Accession # Q14954
C-term
Synonyms
KIR2DS1; CD158 antigen-like family member H; MHC class I NK cell receptor Eb6 ActI
AA Sequence

HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Molecular Weight

Approximately 34 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KIR2DS1 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIR2DS1 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71823
Quantity:
MCE Japan Authorized Agent: