LD78-beta/CCL3L1 Protein, Human (HEK293 His)

LD78-beta/CCL3L1 Protein, Human (HEK293 His) is a multiallelic copy number variable, which plays a crucial role in immunoregulatory and hosts defense through the production of macrophage inflammatory protein (MIP)-1α.

Among the reported genes with copy number variation (CNV), C Chemokine Ligand 3 Like 1 (CCL3L1) has been identified as one of the prominent genes with CNV in the current research field. CCL3L1 is clustered on chromosome 17q12. This gene showed involvement in segmental duplication which was enriched with the immune response gene. CCL3L1 encodes for LD78β, the isoforms of macrophage inflammatory protein 1α (MIP-1α) which only differs by three amino acids of the CCL3 mature protein (LD78α). The truncated-2 form of LD78β produced by CCL3L1 leads to high binding affinity to the CC chemokine receptor (CCR) 1 and 5^[1].

Human

HEK293

C-6*His

P16619 (A24-A93)

414062  [NCBI]/ 6349  [NCBI]

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAHHHHHH

Approximately 16 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Jalilah Jamaluddin, et al. Copy number variation of CCL3L1 among three major ethnic groups in Malaysia. BMC Genet. 2020 Jan 3;21(1):1.  [Content Brief]