LDHA Protein, Rat (His)

The LDHA protein facilitates the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the concomitant exchange of NADH and NAD(+).LDHA Protein, Rat (His) is the recombinant rat-derived LDHA protein, expressed by E.coli , with N-His labeled tag.

LDHA Protein, an isoform of lactate dehydrogenase, is vital in cellular metabolism, converting pyruvate to lactate for energy production in anaerobic conditions. Understanding LDHA Protein's functions is crucial for studying metabolic disorders and developing therapies targeting altered metabolism in cancer and other diseases.

Measured by its ability to reduce pyruvate to lactate. The specific activity is 70337.62058 pmol/min/μg, as measured under the described conditions.

Rat

E. coli

N-His

P04642 (M1-F332)

24533  [NCBI]

MAALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF

Approximately 38.7 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 50 mM NaCl or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.