1. Recombinant Proteins
  2. Others
  3. LIV-1/SLC39A6 Protein, Cynomolgus (Sf9, His)

LIV-1/SLC39A6 is a zinc influx transporter that regulates zinc homeostasis and induces epithelial-mesenchymal transition (EMT). Used in conjunction with SLC39A10, it can promote cellular zinc absorption and trigger EMT. LIV-1/SLC39A6 Protein, Cynomolgus (Sf9, His) is the recombinant cynomolgus-derived LIV-1/SLC39A6 protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of LIV-1/SLC39A6 Protein, Cynomolgus (Sf9, His) is 289 a.a., with molecular weight of ~45 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LIV-1/SLC39A6 is a zinc influx transporter that regulates zinc homeostasis and induces epithelial-mesenchymal transition (EMT). Used in conjunction with SLC39A10, it can promote cellular zinc absorption and trigger EMT. LIV-1/SLC39A6 Protein, Cynomolgus (Sf9, His) is the recombinant cynomolgus-derived LIV-1/SLC39A6 protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of LIV-1/SLC39A6 Protein, Cynomolgus (Sf9, His) is 289 a.a., with molecular weight of ~45 kDa.

Background

LIV-1/SLC39A6, a zinc-influx transporter, intricately regulates zinc homeostasis and contributes to the induction of epithelial-to-mesenchymal transition (EMT). Functionally, when forming a heterodimer with SLC39A10, this complex mediates cellular zinc uptake, serving as a pivotal trigger for EMT. The SLC39A10-SLC39A6 heterodimer not only controls NCAM1 phosphorylation but also influences its integration into focal adhesion complexes during EMT. The zinc influx facilitated by this heterodimeric complex plays a crucial role in inactivating GSK3B, leading to nuclear accumulation of unphosphorylated SNAI1, which subsequently down-regulates adherence genes like CDH1, thereby promoting loss of cell adherence. Beyond its involvement in EMT, the SLC39A10-SLC39A6 heterodimer plays a fundamental role in initiating mitosis by importing zinc into cells, triggering a pathway that culminates in the onset of mitosis. Additionally, this transporter complex contributes to T-cell receptor signaling regulation and facilitates proper zinc influx for meiotic progression during the oocyte-to-egg transition.

Biological Activity

Immobilized Cynomolgus LIV-1 His at 2 μg/mL (100 μL/well) can bind Anti-LIV-1 Antibody Human IgG1 with a linear range of ≤3 ng/mL.

Species

Cynomolgus

Source

Sf9 insect cells

Tag

C-His

Accession

XP_005586923 (L21-I309)

Gene ID
Molecular Construction
N-term
Reg1 (L21-I309)
Accession # XP_005586923
His
C-term
Synonyms
SLC39A6; LIV-1; ZIP6; Zinc transporter ZIP6; ZIP-6
AA Sequence

LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI

Molecular Weight

Approximately 45 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized a 0.22 μm filtered solution ofPBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LIV-1/SLC39A6 Protein, Cynomolgus (Sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LIV-1/SLC39A6 Protein, Cynomolgus (Sf9, His)
Cat. No.:
HY-P78569
Quantity:
MCE Japan Authorized Agent: