1. Recombinant Proteins
  2. Others
  3. MAGOH Protein, Human (His)

MAGOH is an important spliceosome component that cooperates with MAGOHB to form the exon junction complex (EJC), which is central to pre-mRNA splicing and nonsense-mediated decay (NMD). EJC affects mRNA metabolism, marks exon-exon junctions, and affects processes such as mRNA export, localization, translation, and NMD. MAGOH Protein, Human (His) is the recombinant human-derived MAGOH protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MAGOH is an important spliceosome component that cooperates with MAGOHB to form the exon junction complex (EJC), which is central to pre-mRNA splicing and nonsense-mediated decay (NMD). EJC affects mRNA metabolism, marks exon-exon junctions, and affects processes such as mRNA export, localization, translation, and NMD. MAGOH Protein, Human (His) is the recombinant human-derived MAGOH protein, expressed by E. coli , with C-6*His labeled tag.

Background

MAGOH is an essential component of the spliceosome, contributing to pre-mRNA splicing processes. Acting redundantly with MAGOHB, it forms the core of the exon junction complex (EJC) and participates in the nonsense-mediated decay (NMD) pathway. The EJC is a dynamic structure involved in various aspects of mRNA metabolism, such as marking the exon-exon junction in mature mRNA and influencing downstream processes like nuclear mRNA export, subcellular mRNA localization, translation efficiency, and NMD. The MAGOH-RBM8A heterodimer, a key element of the EJC, inhibits the ATPase activity of EIF4A3, stabilizing the ATP-bound EJC core on spliced mRNA. This stable conformation interacts with the EJC regulator PYM1 in the cytoplasm, leading to EJC disassembly and enhancing translation of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex. MAGOH is also implicated in the splicing modulation of apoptotic genes, inhibiting the formation of proapoptotic isoforms like Bcl-X(S). In association with RBM8A, MAGOH is a core component of the mRNA splicing-dependent EJC and is identified in the spliceosome C complex.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P61326-1/NP_002361.1 (M1-I146)

Gene ID
Molecular Construction
N-term
MAGOH (M1-I146)
Accession # P61326-1/NP_002361.1
His
C-term
Synonyms
Protein mago nashi homolog; MAGOH; MAGOHA
AA Sequence

MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI

Molecular Weight

Approximately 17 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 137 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4, 20% Glycerol, pH 4.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MAGOH Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MAGOH Protein, Human (His)
Cat. No.:
HY-P76484
Quantity:
MCE Japan Authorized Agent: