1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Mesothelin Protein, Mouse (HEK293, His)

Mesothelin Protein, Mouse (HEK293, His)

Cat. No.: HY-P70856
SDS COA Handling Instructions

Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating cell interactions. Additionally, Megakaryocyte-potentiating factor (MPF) enhances megakaryocyte colony formation, indicating its involvement in the development of these specialized blood cell colonies. Mesothelin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Mesothelin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Mesothelin Protein, Mouse (HEK293, His) is 303 a.a., with molecular weight of 38-55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating cell interactions. Additionally, Megakaryocyte-potentiating factor (MPF) enhances megakaryocyte colony formation, indicating its involvement in the development of these specialized blood cell colonies. Mesothelin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Mesothelin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Mesothelin Protein, Mouse (HEK293, His) is 303 a.a., with molecular weight of 38-55 kDa.

Background

Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating interactions between cells. Additionally, Megakaryocyte-potentiating factor (MPF) has been associated with the enhancement of megakaryocyte colony formation, indicating its involvement in processes related to the development of these specialized blood cell colonies.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q61468 (D298-S600)

Gene ID
Molecular Construction
N-term
Mesothelin (D298-S600)
Accession # Q61468
6*His
C-term
Synonyms
Mesothelin; Msln; Mes; Mpf
AA Sequence

DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS

Molecular Weight

38-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Mesothelin Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Mesothelin Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70856
Quantity:
MCE Japan Authorized Agent: