Oleosin L Protein, Sesamum indicum (Cell-Free, His)

The oleosin L protein plays a structural role in stabilizing liposomes during seed drying, preventing oil coalescence and affecting liposome integrity. Its potential interactions with lipid and phospholipid moieties suggest the involvement of multiple molecules. Oleosin L Protein, Sesamum indicum (Cell-Free, His) is the recombinant Oleosin L protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of Oleosin L Protein, Sesamum indicum (Cell-Free, His) is 145 a.a., with molecular weight of 16.7 kDa.

The Oleosin L protein appears to serve a structural role in stabilizing lipid bodies during seed desiccation by preventing the coalescence of oil, highlighting its importance in seed physiology. Its potential interaction with both lipid and phospholipid moieties of lipid bodies suggests a versatile molecular engagement, possibly influencing the lipid body's integrity and function. Furthermore, Oleosin L may play a role in providing recognition signals for specific lipase anchorage, indicating its involvement in lipolysis during seedling growth. The multifaceted functions attributed to Oleosin L underscore its significance in orchestrating essential processes related to lipid metabolism and seed development.

Others

E. coli Cell-free

N-10*His

Q9XHP2 (M1-S145)

/

MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQPVAGSQTS

16.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.