1. Recombinant Proteins
  2. Others
  3. Oleosin L Protein, Sesamum indicum (Cell-Free, His)

Oleosin L Protein, Sesamum indicum (Cell-Free, His)

Cat. No.: HY-P702395
Data Sheet Handling Instructions Technical Support

The oleosin L protein plays a structural role in stabilizing liposomes during seed drying, preventing oil coalescence and affecting liposome integrity. Its potential interactions with lipid and phospholipid moieties suggest the involvement of multiple molecules. Oleosin L Protein, Sesamum indicum (Cell-Free, His) is the recombinant Oleosin L protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The oleosin L protein plays a structural role in stabilizing liposomes during seed drying, preventing oil coalescence and affecting liposome integrity. Its potential interactions with lipid and phospholipid moieties suggest the involvement of multiple molecules. Oleosin L Protein, Sesamum indicum (Cell-Free, His) is the recombinant Oleosin L protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Background

The Oleosin L protein appears to serve a structural role in stabilizing lipid bodies during seed desiccation by preventing the coalescence of oil, highlighting its importance in seed physiology. Its potential interaction with both lipid and phospholipid moieties of lipid bodies suggests a versatile molecular engagement, possibly influencing the lipid body's integrity and function. Furthermore, Oleosin L may play a role in providing recognition signals for specific lipase anchorage, indicating its involvement in lipolysis during seedling growth. The multifaceted functions attributed to Oleosin L underscore its significance in orchestrating essential processes related to lipid metabolism and seed development.

Species

Others

Source

E. coli Cell-free

Tag

N-10*His

Accession

Q9XHP2 (M1-S145)

Gene ID

/

Molecular Construction
N-term
10*His
Oleosin L (M1-S145)
Accession # Q9XHP2
C-term
Synonyms
Oleosin L; Allergen Ses i 5; Oleosin 15 kDa
AA Sequence

MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQPVAGSQTS

Molecular Weight

16.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Oleosin L Protein, Sesamum indicum (Cell-Free, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Oleosin L Protein, Sesamum indicum (Cell-Free, His)
Cat. No.:
HY-P702395
Quantity:
MCE Japan Authorized Agent: