1. Recombinant Proteins
  2. Others
  3. Outer membrane protein X/OmpX Protein, E.coli (Myc, His)

Outer membrane protein X/OmpX Protein, E.coli (Myc, His)

Cat. No.: HY-P71494
COA Handling Instructions

Outer membrane protein X/OmpX protein is an important member of the outer membrane OOP (TC 1.B.6) superfamily, specifically belonging to the OmpX family. It plays a vital role in cellular processes and shares common structural and functional features among the OmpX family. Outer membrane protein X/OmpX Protein, E.coli (Myc, His) is the recombinant E. coli-derived Outer membrane protein X/OmpX protein, expressed by E. coli , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $320 In-stock
50 μg $700 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Outer membrane protein X/OmpX Protein, E.coli (Myc, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Outer membrane protein X/OmpX protein is an important member of the outer membrane OOP (TC 1.B.6) superfamily, specifically belonging to the OmpX family. It plays a vital role in cellular processes and shares common structural and functional features among the OmpX family. Outer membrane protein X/OmpX Protein, E.coli (Myc, His) is the recombinant E. coli-derived Outer membrane protein X/OmpX protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Background

The Outer membrane protein X/OmpX Protein is an integral member of the outer membrane OOP (TC 1.B.6) superfamily, specifically belonging to the OmpX family. This protein plays a crucial role in cellular processes, and its affiliation with the OmpX family suggests shared structural and functional characteristics within this superfamily. As a member of the outer membrane OOP superfamily, OmpX is likely involved in membrane-related functions, possibly contributing to the stability and integrity of the outer membrane. The study of Outer membrane protein X/OmpX provides insights into the broader understanding of the outer membrane OOP superfamily, shedding light on potential roles and interactions that impact cellular dynamics and membrane integrity. Further exploration of the specific functions and features of OmpX can contribute to a comprehensive understanding of its significance within the context of membrane biology.

Species

E.coli

Source

E. coli

Tag

N-His;C-Myc

Accession

P0A919 (A24-F171)

Gene ID

66670913  [NCBI]

Molecular Construction
N-term
10*His
OmpX (A24-F171)
Accession # P0A919
Myc
C-term
Synonyms
ompX; Z1036; ECs0892; Outer membrane protein X
AA Sequence

ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF

Molecular Weight

Approximately 27 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Outer membrane protein X/OmpX Protein, E.coli (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Outer membrane protein X/OmpX Protein, E.coli (Myc, His)
Cat. No.:
HY-P71494
Quantity:
MCE Japan Authorized Agent: