2. Recombinant Proteins
  3. Others
  4. Outer membrane protein X/OmpX Protein, E.coli (Myc, His)

Outer membrane protein X/OmpX Protein, E.coli (Myc, His)

Cat. No.: HY-P71494
Data Sheet
SDS
COA
Handling Instructions Technical Support

Protein solubilization and storage

Help & FAQs

Outer membrane protein X/OmpX protein is an important member of the outer membrane OOP (TC 1.B.6) superfamily, specifically belonging to the OmpX family. It plays a vital role in cellular processes and shares common structural and functional features among the OmpX family. Outer membrane protein X/OmpX Protein, E.coli (Myc, His) is the recombinant E. coli-derived Outer membrane protein X/OmpX protein, expressed by E. coli , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg USD 320 In-stock
50 μg USD 700 In-stock
100 μg   Get quote  

Get it by tomorrow April 16 for select sizes. Order within 1 hrs 22 mins.

or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Outer membrane protein X/OmpX Protein, E.coli (Myc, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Outer membrane protein X/OmpX protein is an important member of the outer membrane OOP (TC 1.B.6) superfamily, specifically belonging to the OmpX family. It plays a vital role in cellular processes and shares common structural and functional features among the OmpX family. Outer membrane protein X/OmpX Protein, E.coli (Myc, His) is the recombinant E. coli-derived Outer membrane protein X/OmpX protein, expressed by E. coli , with N-His, C-Myc labeled tag.
Background

The Outer membrane protein X/OmpX Protein is an integral member of the outer membrane OOP (TC 1.B.6) superfamily, specifically belonging to the OmpX family. This protein plays a crucial role in cellular processes, and its affiliation with the OmpX family suggests shared structural and functional characteristics within this superfamily. As a member of the outer membrane OOP superfamily, OmpX is likely involved in membrane-related functions, possibly contributing to the stability and integrity of the outer membrane. The study of Outer membrane protein X/OmpX provides insights into the broader understanding of the outer membrane OOP superfamily, shedding light on potential roles and interactions that impact cellular dynamics and membrane integrity. Further exploration of the specific functions and features of OmpX can contribute to a comprehensive understanding of its significance within the context of membrane biology.
Species

E.coli
Source

E. coli
Tag

N-His;C-Myc
Accession

P0A919 (A24-F171)
Gene ID

917632  [NCBI]
Molecular Construction
N-term
10*His
OmpX (A24-F171)
Accession # P0A919
Myc
C-term
Synonyms
ompX; Z1036; ECs0892; Outer membrane protein X
AA Sequence

ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF

Molecular Weight

Approximately 27 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder
Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.
Documentation
Data Sheet (235 KB) SDS (251 KB)

COA (219 KB)

Handling Instructions (2659 KB)

Outer membrane protein X/OmpX Protein, E.coli (Myc, His) Related Classifications

Help & FAQs
  • How should lyophilized recombinant proteins be reconstituted and stored?

    1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.

  • How should solution-form recombinant proteins be stored?

    1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that

  • Why is it necessary to add carrier proteins?

    Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.

  • Carrier protein types and options?

    In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Outer membrane protein X/OmpX Protein, E.coli (Myc, His)
Cat. No.:
HY-P71494
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (251 KB) Français - FR (251 KB) Deutsch - DE (251 KB) Norwegian - NO (251 KB) Español - ES (251 KB) Swedish - SV (251 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.