Outer membrane protein X/OmpX Protein, E.coli (Myc, His)

Outer membrane protein X/OmpX protein is an important member of the outer membrane OOP (TC 1.B.6) superfamily, specifically belonging to the OmpX family. It plays a vital role in cellular processes and shares common structural and functional features among the OmpX family. Outer membrane protein X/OmpX Protein, E.coli (Myc, His) is the recombinant E. coli-derived Outer membrane protein X/OmpX protein, expressed by E. coli , with N-His, C-Myc labeled tag.

The Outer membrane protein X/OmpX Protein is an integral member of the outer membrane OOP (TC 1.B.6) superfamily, specifically belonging to the OmpX family. This protein plays a crucial role in cellular processes, and its affiliation with the OmpX family suggests shared structural and functional characteristics within this superfamily. As a member of the outer membrane OOP superfamily, OmpX is likely involved in membrane-related functions, possibly contributing to the stability and integrity of the outer membrane. The study of Outer membrane protein X/OmpX provides insights into the broader understanding of the outer membrane OOP superfamily, shedding light on potential roles and interactions that impact cellular dynamics and membrane integrity. Further exploration of the specific functions and features of OmpX can contribute to a comprehensive understanding of its significance within the context of membrane biology.

E.coli

E. coli

N-His;C-Myc

P0A919 (A24-F171)

917632  [NCBI]

ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF

Approximately 27 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.