1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Serine/Threonine Kinase Proteins
  4. PAK5 Protein, Human (Baculovirus, His)

PAK5 is a dynamic serine/threonine kinase that affects cytoskeletal regulation, cell migration, proliferation, and survival through multiple pathways. Activation triggers autophosphorylation, affecting RAF1 kinase activity and promoting cell survival through BAD phosphorylation. PAK5 Protein, Human (Baculovirus, His) is the recombinant human-derived PAK5 protein, expressed by Sf9 insect cells , with N-6*His labeled tag. The total length of PAK5 Protein, Human (Baculovirus, His) is 293 a.a., with molecular weight of ~34.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PAK5 is a dynamic serine/threonine kinase that affects cytoskeletal regulation, cell migration, proliferation, and survival through multiple pathways. Activation triggers autophosphorylation, affecting RAF1 kinase activity and promoting cell survival through BAD phosphorylation. PAK5 Protein, Human (Baculovirus, His) is the recombinant human-derived PAK5 protein, expressed by Sf9 insect cells , with N-6*His labeled tag. The total length of PAK5 Protein, Human (Baculovirus, His) is 293 a.a., with molecular weight of ~34.9 kDa.

Background

PAK5, a serine/threonine protein kinase, is a versatile player in various signaling pathways, influencing cytoskeleton regulation, cell migration, proliferation, and cell survival. Activation by diverse effectors, including growth factor receptors or active CDC42 and RAC1, induces a conformational change and subsequent autophosphorylation on multiple serine and/or threonine residues. PAK5's impact extends to the phosphorylation of the proto-oncogene RAF1, enhancing its kinase activity, and the promotion of cell survival through the phosphorylation of the BCL2 antagonist of cell death, BAD. Furthermore, PAK5 phosphorylates CTNND1, likely regulating cytoskeletal organization and cell morphology. It plays a role in microtubule stability by inhibiting MARK2 and simultaneously destabilizes the F-actin network, resulting in the disappearance of stress fibers and focal adhesions. PAK5 emerges as a key regulator at the intersection of diverse cellular processes.

Species

Human

Source

Sf9 insect cells

Tag

N-6*His

Accession

Q8TB93 (M1-Q293)

Gene ID
Molecular Construction
N-term
6*His
PAK5 (M1-Q293)
Accession # Q8TB93
C-term
Synonyms
erine/threonine-protein kinase PAK 5; PAK5
AA Sequence

MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ

Molecular Weight

Approximately 34.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PAK5 Protein, Human (Baculovirus, His) Related Classifications

Help & FAQs
  • How should lyophilized recombinant proteins be reconstituted and stored?

    1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.

  • How should solution-form recombinant proteins be stored?

    1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that

  • Why is it necessary to add carrier proteins?

    Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.

  • Carrier protein types and options?

    In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PAK5 Protein, Human (Baculovirus, His)
Cat. No.:
HY-P72065
Quantity:
MCE Japan Authorized Agent: