PAK5 Protein, Human (Baculovirus, His)

PAK5 is a dynamic serine/threonine kinase that affects cytoskeletal regulation, cell migration, proliferation, and survival through multiple pathways. Activation triggers autophosphorylation, affecting RAF1 kinase activity and promoting cell survival through BAD phosphorylation. PAK5 Protein, Human (Baculovirus, His) is the recombinant human-derived PAK5 protein, expressed by Sf9 insect cells , with N-6*His labeled tag. The total length of PAK5 Protein, Human (Baculovirus, His) is 293 a.a., with molecular weight of ~34.9 kDa.

PAK5, a serine/threonine protein kinase, is a versatile player in various signaling pathways, influencing cytoskeleton regulation, cell migration, proliferation, and cell survival. Activation by diverse effectors, including growth factor receptors or active CDC42 and RAC1, induces a conformational change and subsequent autophosphorylation on multiple serine and/or threonine residues. PAK5's impact extends to the phosphorylation of the proto-oncogene RAF1, enhancing its kinase activity, and the promotion of cell survival through the phosphorylation of the BCL2 antagonist of cell death, BAD. Furthermore, PAK5 phosphorylates CTNND1, likely regulating cytoskeletal organization and cell morphology. It plays a role in microtubule stability by inhibiting MARK2 and simultaneously destabilizes the F-actin network, resulting in the disappearance of stress fibers and focal adhesions. PAK5 emerges as a key regulator at the intersection of diverse cellular processes.

Human

Sf9 insect cells

N-6*His

Q8TB93 (M1-Q293)

57144  [NCBI]

MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ

Approximately 34.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.