1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Serine/Threonine Kinase Proteins
  4. PAK5 Protein, Human (Baculovirus, His)

PAK5 is a dynamic serine/threonine kinase that affects cytoskeletal regulation, cell migration, proliferation, and survival through multiple pathways. Activation triggers autophosphorylation, affecting RAF1 kinase activity and promoting cell survival through BAD phosphorylation. PAK5 Protein, Human (Baculovirus, His) is the recombinant human-derived PAK5 protein, expressed by Sf9 insect cells , with N-6*His labeled tag. The total length of PAK5 Protein, Human (Baculovirus, His) is 293 a.a., with molecular weight of ~34.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PAK5 is a dynamic serine/threonine kinase that affects cytoskeletal regulation, cell migration, proliferation, and survival through multiple pathways. Activation triggers autophosphorylation, affecting RAF1 kinase activity and promoting cell survival through BAD phosphorylation. PAK5 Protein, Human (Baculovirus, His) is the recombinant human-derived PAK5 protein, expressed by Sf9 insect cells , with N-6*His labeled tag. The total length of PAK5 Protein, Human (Baculovirus, His) is 293 a.a., with molecular weight of ~34.9 kDa.

Background

PAK5, a serine/threonine protein kinase, is a versatile player in various signaling pathways, influencing cytoskeleton regulation, cell migration, proliferation, and cell survival. Activation by diverse effectors, including growth factor receptors or active CDC42 and RAC1, induces a conformational change and subsequent autophosphorylation on multiple serine and/or threonine residues. PAK5's impact extends to the phosphorylation of the proto-oncogene RAF1, enhancing its kinase activity, and the promotion of cell survival through the phosphorylation of the BCL2 antagonist of cell death, BAD. Furthermore, PAK5 phosphorylates CTNND1, likely regulating cytoskeletal organization and cell morphology. It plays a role in microtubule stability by inhibiting MARK2 and simultaneously destabilizes the F-actin network, resulting in the disappearance of stress fibers and focal adhesions. PAK5 emerges as a key regulator at the intersection of diverse cellular processes.

Species

Human

Source

Sf9 insect cells

Tag

N-6*His

Accession

Q8TB93 (M1-Q293)

Gene ID
Molecular Construction
N-term
6*His
PAK5 (M1-Q293)
Accession # Q8TB93
C-term
Synonyms
erine/threonine-protein kinase PAK 5; PAK5
AA Sequence

MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ

Molecular Weight

Approximately 34.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PAK5 Protein, Human (Baculovirus, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PAK5 Protein, Human (Baculovirus, His)
Cat. No.:
HY-P72065
Quantity:
MCE Japan Authorized Agent: