1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Epithelial cell CD Proteins
  4. PD-L1 PD-L1
  5. PD-L1 Protein, Canine (HEK293, Fc)

PD-L1 Protein, Canine (HEK293, Fc) is a trans-membrane protein that is considered to be a co-inhibitory factor of the immune response. The amino acid sequence of PD-L1 is encoded by 7 exons, which form a protein of ~40 kDa. PD-L1 is a type I transmembrane protein, is part of the immunoglobulin (Ig) superfamily and is composed of IgV-like and IgC-like extracellular domains, a hydrophobic transmembrane domain and a short cytoplasmic tail composed of 30 amino acids. PD-L1 can combine with PD-1 to reduce the proliferation of PD-1 positive cells, inhibit their cytokine secretion and induce apoptosis. PD-L1 also plays an important role in various malignancies where it can attenuate the host immune response to tumor cells. PD-L1 Protein, Canine (HEK293, Fc) is the recombinant canine-derived PD-L1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of PD-L1 Protein, Canine (HEK293, Fc) is 218 a.a., with molecular weight of ~70-80 & 140-160 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PD-L1 Protein, Canine (HEK293, Fc) is a trans-membrane protein that is considered to be a co-inhibitory factor of the immune response. The amino acid sequence of PD-L1 is encoded by 7 exons, which form a protein of ~40 kDa. PD-L1 is a type I transmembrane protein, is part of the immunoglobulin (Ig) superfamily and is composed of IgV-like and IgC-like extracellular domains, a hydrophobic transmembrane domain and a short cytoplasmic tail composed of 30 amino acids. PD-L1 can combine with PD-1 to reduce the proliferation of PD-1 positive cells, inhibit their cytokine secretion and induce apoptosis. PD-L1 also plays an important role in various malignancies where it can attenuate the host immune response to tumor cells[1][2]. PD-L1 Protein, Canine (HEK293, Fc) is the recombinant canine-derived PD-L1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of PD-L1 Protein, Canine (HEK293, Fc) is 218 a.a., with molecular weight of ~70-80 & 140-160 kDa, respectively.

Background

PD-L1 is the third member of the B7 family that does not bind CD28, cytotoxic T-lymphocyte A4 or inducible co-stimulator, and has 10-25% homology with B7.1 and B7.2 proteins. PD-L1 is encoded by the PDCDL1 gene, which was discovered at p24.1 on human chromosome 9[1].
The most important role of PD-L1 is binding with programmed death-1 (PD-1; CD279), a type I transmembrane receptor that is 288 amino acids long and was first found on T cells. The engagement of PD-L1 and PD-1 on cancer cells activates Src homology region 2 domain-containing phosphatases, which inhibit the T cell receptor (TCR) pathway. Inhibition of the TCR pathway leads to inhibition of T cell activities, including proliferation, survival and cytokine production, such as that of IL-2, tumour necrosis factor α (TNF-α) and interferon γ (IFN-γ), as well as the inhibition of B7-1 and T cell tolerance[1].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Canine PD-1 is present at 0.5 μg/mL, can bind Recombinant Canine PD-L1. The ED50 for this effect is 4.116 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Canine PD-1 is present at 0.5 μg/mL, can bind Recombinant Canine PD-L1. The ED50 for this effect is 4.116 μg/mL.
Species

Canine

Source

HEK293

Tag

C-hFc

Accession

NP_001278901 (F19-R236)

Gene ID
Molecular Construction
N-term
PD-L1 (F19-R236)
Accession # NP_001278901
hFc
C-term
Synonyms
Programmed cell death 1 ligand 1; PD-L1; B7-H1; CD274; PDL1
AA Sequence

FTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASER

Molecular Weight

Approximately 70-80&140-160 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PD-L1 Protein, Canine (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-L1 Protein, Canine (HEK293, Fc)
Cat. No.:
HY-P73717
Quantity:
MCE Japan Authorized Agent: