1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Epithelial cell CD Proteins
  4. PD-L1 PD-L1
  5. PD-L1 Protein, Rat (HEK293, His)

PD-L1 Protein, Rat (HEK293, His)

Cat. No.: HY-P73365
COA Handling Instructions

PD-L1 (Programmed death-ligand 1) critically regulates T cell proliferation and migration, acting as a biomarker for periodontitis and pre-eclampsia. CD274 is its human ortholog. Biased expression in the thymus (RPKM 102.9), spleen (RPKM 58.3), and other tissues emphasizes PD-L1's centrality in immune regulation across diverse physiological and pathological conditions. PD-L1 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L1 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of PD-L1 Protein, Rat (HEK293, His) is 221 a.a., with molecular weight of ~41.79 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $43 In-stock
10 μg $73 In-stock
50 μg $205 In-stock
100 μg $350 In-stock
500 μg $980 In-stock
1 mg $1665 In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PD-L1 (Programmed death-ligand 1) critically regulates T cell proliferation and migration, acting as a biomarker for periodontitis and pre-eclampsia. CD274 is its human ortholog. Biased expression in the thymus (RPKM 102.9), spleen (RPKM 58.3), and other tissues emphasizes PD-L1's centrality in immune regulation across diverse physiological and pathological conditions. PD-L1 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L1 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of PD-L1 Protein, Rat (HEK293, His) is 221 a.a., with molecular weight of ~41.79 kDa.

Background

Programmed death-ligand 1 (PD-L1) plays a critical role in the positive regulation of T cell proliferation and cell migration. Situated on the cell surface, PD-L1 serves as a biomarker for conditions such as periodontitis and pre-eclampsia. Its orthologous counterpart in humans is CD274 (CD274 molecule). With biased expression observed in the thymus (RPKM 102.9), spleen (RPKM 58.3), and various other tissues, PD-L1 is central to immune regulation and holds significance in the context of diverse physiological and pathological conditions.

Biological Activity

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is 0.1872 μg/ml in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 5.34×10^3 units/mg.

  • Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.1872 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 5.34×103 units/mg.
Species

Rat

Source

HEK293

Tag

C-10*His

Accession

NP_001178883.1 (A18-T238)

Gene ID
Molecular Construction
N-term
PD-L1 (A18-T238)
Accession # NP_001178883.1
10*His
C-term
Synonyms
Programmed cell death 1 ligand 1; PD-L1; B7-H1; CD274; PDL1
AA Sequence

AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT

Molecular Weight

Approximately 41.79 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PD-L1 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-L1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P73365
Quantity:
MCE Japan Authorized Agent: