1. Recombinant Proteins
  2. Others
  3. PDCD8/AIFM1 Protein, Human (His)

PDCD8/AIFM1 protein has the dual functions of NADH oxidoreductase and apoptosis regulator, and translocates from the mitochondrial intermembrane space to the cytoplasm and nucleus in response to apoptotic stimuli. It acts through a caspase-independent pathway, inducing “parthanatos” characterized by fragmentation of chromosomal DNA. PDCD8/AIFM1 Protein, Human (His) is the recombinant human-derived PDCD8/AIFM1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PDCD8/AIFM1 Protein, Human (His) is 493 a.a., with molecular weight of ~68.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDCD8/AIFM1 protein has the dual functions of NADH oxidoreductase and apoptosis regulator, and translocates from the mitochondrial intermembrane space to the cytoplasm and nucleus in response to apoptotic stimuli. It acts through a caspase-independent pathway, inducing “parthanatos” characterized by fragmentation of chromosomal DNA. PDCD8/AIFM1 Protein, Human (His) is the recombinant human-derived PDCD8/AIFM1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PDCD8/AIFM1 Protein, Human (His) is 493 a.a., with molecular weight of ~68.0 kDa.

Background

PDCD8/AIFM1 protein exhibits dual functionality, serving as both an NADH oxidoreductase and a regulator of apoptosis. In response to apoptotic stimuli, it undergoes translocation from the mitochondrial intermembrane space to the cytosol and nucleus, functioning as a proapoptotic factor through a caspase-independent pathway. This release into the cytoplasm is facilitated by its binding to poly-ADP-ribose chains. The soluble form (AIFsol) found in the nucleus induces 'parthanatos,' characterized by caspase-independent fragmentation of chromosomal DNA. Additionally, PDCD8/AIFM1 interacts with EIF3G, inhibiting the EIF3 machinery and protein synthesis while activating caspase-7 to amplify apoptosis. It plays a critical role in caspase-independent, pyknotic cell death induced by hydrogen peroxide. In normal mitochondrial metabolism, PDCD8/AIFM1 contributes significantly to the regulation of respiratory chain biogenesis by interacting with CHCHD4 and controlling CHCHD4 mitochondrial import. Notably, PDCD8/AIFM1 demonstrates NADH oxidoreductase activity and does not induce nuclear apoptosis.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O95831 (E121-D613)

Gene ID
Molecular Construction
N-term
6*His
AIFM1 (E121-D613)
Accession # O95831
C-term
Synonyms
rHuApoptosis-inducing factor 1, mitochondrial/AIFM1, His; Apoptosis-Inducing Factor 1 Mitochondrial; Programmed Cell Death Protein 8; AIFM1; AIF; PDCD8
AA Sequence

EEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

Molecular Weight

Approximately 68.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PDCD8/AIFM1 Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDCD8/AIFM1 Protein, Human (His)
Cat. No.:
HY-P7856
Quantity:
MCE Japan Authorized Agent: