PDCD8/AIFM1 Protein, Human (His)

PDCD8/AIFM1 protein has the dual functions of NADH oxidoreductase and apoptosis regulator, and translocates from the mitochondrial intermembrane space to the cytoplasm and nucleus in response to apoptotic stimuli. It acts through a caspase-independent pathway, inducing “parthanatos” characterized by fragmentation of chromosomal DNA. PDCD8/AIFM1 Protein, Human (His) is the recombinant human-derived PDCD8/AIFM1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PDCD8/AIFM1 Protein, Human (His) is 493 a.a., with molecular weight of ~68.0 kDa.

PDCD8/AIFM1 protein exhibits dual functionality, serving as both an NADH oxidoreductase and a regulator of apoptosis. In response to apoptotic stimuli, it undergoes translocation from the mitochondrial intermembrane space to the cytosol and nucleus, functioning as a proapoptotic factor through a caspase-independent pathway. This release into the cytoplasm is facilitated by its binding to poly-ADP-ribose chains. The soluble form (AIFsol) found in the nucleus induces 'parthanatos,' characterized by caspase-independent fragmentation of chromosomal DNA. Additionally, PDCD8/AIFM1 interacts with EIF3G, inhibiting the EIF3 machinery and protein synthesis while activating caspase-7 to amplify apoptosis. It plays a critical role in caspase-independent, pyknotic cell death induced by hydrogen peroxide. In normal mitochondrial metabolism, PDCD8/AIFM1 contributes significantly to the regulation of respiratory chain biogenesis by interacting with CHCHD4 and controlling CHCHD4 mitochondrial import. Notably, PDCD8/AIFM1 demonstrates NADH oxidoreductase activity and does not induce nuclear apoptosis.

Human

E. coli

N-6*His

O95831 (E121-D613)

9131  [NCBI]

EEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

Approximately 68.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.