PEA15 Protein, Human

The PEA15 protein is a regulator of multiple cellular processes that blocks Ras-mediated integrin inhibition and modulates the ERK MAP kinase cascade. It inhibits RPS6KA3 activity by sequestering RPS6KA3 in the cytoplasm, regulating key cellular pathways. PEA15 Protein, Human is the recombinant human-derived PEA15 protein, expressed by E. coli , with tag free. The total length of PEA15 Protein, Human is 130 a.a., with molecular weight of 12-16 kDa.

The PEA15 protein exerts diverse regulatory functions in cellular processes, including blocking Ras-mediated inhibition of integrin activation and modulating the ERK MAP kinase cascade. PEA15 plays a pivotal role in inhibiting the activities of RPS6KA3 by sequestering it in the cytoplasm, thereby regulating key cellular pathways. Additionally, PEA15 serves as a potent inhibitor of both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Its involvement extends to the regulation of glucose transport, wherein PEA15 controls the content of SLC2A1 glucose transporters on the plasma membrane and modulates the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface. Functionally, PEA15 forms transient interactions with PLD1 and PLD2, further contributing to its intricate regulatory network. Notably, PEA15 engages in direct interactions with key cellular players such as RPS6KA3, MAPK3, MAPK1, CASP8, and FADD, underscoring its multifaceted role in cellular signaling and homeostasis.

Human

E. coli

Tag Free

Q15121 ( M1-A130)

8682  [NCBI]

MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

12-16 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.