1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. PGD2 Synthase/PTGDS Protein, Rat (HEK293, His)

PGD2 Synthase/PTGDS Protein, Rat (HEK293, His)

Cat. No.: HY-P73709
SDS COA Handling Instructions

The PGD2 synthase/PTGDS protein converts PGH2 to PGD2, which regulates smooth muscle and inhibits platelet aggregation.It affects central nervous system functions including sedation, NREM sleep, and potential anti-apoptotic effects on oligodendrocytes.PGD2 Synthase/PTGDS Protein, Rat (HEK293, His) is the recombinant rat-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PGD2 synthase/PTGDS protein converts PGH2 to PGD2, which regulates smooth muscle and inhibits platelet aggregation.It affects central nervous system functions including sedation, NREM sleep, and potential anti-apoptotic effects on oligodendrocytes.PGD2 Synthase/PTGDS Protein, Rat (HEK293, His) is the recombinant rat-derived PGD2 Synthase/PTGDS protein, expressed by HEK293 , with C-His, C-6*His labeled tag.

Background

The PGD2 Synthase, also known as PTGDS protein, is a key enzymatic player in diverse physiological processes. It catalyzes the conversion of PGH2 to PGD2, a prostaglandin essential for smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Beyond its vascular functions, PTGDS is intricately involved in various central nervous system (CNS) activities, including sedation, NREM sleep, and PGE2-induced allodynia, and may exert an anti-apoptotic role in oligodendrocytes. The protein exhibits a broad substrate-binding capacity, interacting with small non-substrate lipophilic molecules like biliverdin, bilirubin, retinal, retinoic acid, and thyroid hormone, potentially acting as a scavenger for harmful hydrophobic molecules and functioning as a secretory retinoid and thyroid hormone transporter. PTGDS is implicated in the development and maintenance of blood barriers, including the blood-brain, blood-retina, blood-aqueous humor, and blood-testis barriers, highlighting its significance in barrier function. Moreover, it plays pivotal roles in both the maturation and maintenance of the central nervous system and the male reproductive system. Additionally, PTGDS participates in PLA2G3-dependent mast cell maturation, where PLA2G3, secreted by immature mast cells, acts upstream to PTGDS to synthesize PGD2. This, in turn, promotes mast cell maturation and degranulation via PTGDR, indicating its involvement in immune responses and cellular maturation.

Species

Rat

Source

HEK293

Tag

C-His;C-6*His

Accession

P22057/NP_037147.1 (Q25-E189)

Gene ID
Molecular Construction
N-term
PTGDS (Q25-E189)
Accession # P22057/NP_037147.1
6*His
C-term
Synonyms
Prostaglandin-H2 D-isomerase; L-PGDS; PGDS2; PTGDS
AA Sequence

QGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKELLFMCQTVVAPSTEGGLNLTSTFLRKNQCETKVMVLQPAGVPGQYTYNSPHWGSFHSLSVVETDYDEYAFLFSKGTKGPGQDFRMATLYSRAQLLKEELKEKFITFSKDQGLTEEDIVFLPQPDKCIQE

Molecular Weight

Approximately 26-29 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PGD2 Synthase/PTGDS Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PGD2 Synthase/PTGDS Protein, Rat (HEK293, His)
Cat. No.:
HY-P73709
Quantity:
MCE Japan Authorized Agent: