1. Recombinant Proteins
  2. Others
  3. PGLYRP1/PGRP-S Protein, Mouse (HEK293, His)

PGLYRP1/PGRP-S Protein, Mouse (HEK293, His)

Cat. No.: HY-P76543
SDS COA Handling Instructions

PGLYRP1/PGRP-S Protein plays a vital role in the innate immune response.It recognizes bacterial peptidoglycan and activates antimicrobial defense mechanisms.PGLYRP1/PGRP-S Protein interacts with other immune molecules, enhancing immune responses against bacterial infections.Understanding its functions can aid in developing strategies to combat bacterial pathogens.PGLYRP1/PGRP-S Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGLYRP1/PGRP-S protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PGLYRP1/PGRP-S Protein plays a vital role in the innate immune response.It recognizes bacterial peptidoglycan and activates antimicrobial defense mechanisms.PGLYRP1/PGRP-S Protein interacts with other immune molecules, enhancing immune responses against bacterial infections.Understanding its functions can aid in developing strategies to combat bacterial pathogens.PGLYRP1/PGRP-S Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGLYRP1/PGRP-S protein, expressed by HEK293 , with C-His labeled tag.

Background

PGLYRP1/PGRP-S, an innate immunity protein, serves multifaceted roles in antimicrobial and antitumor defense systems. Functioning as a pattern receptor, it binds to murein peptidoglycans (PGN) from Gram-positive bacteria, thereby exerting bactericidal activity. Additionally, it forms an equimolar complex with heat shock protein HSPA1A, triggering programmed cell death through apoptosis and necroptosis in tumor cell lines by activating the TNFR1 receptor. Collaborating with the Ca(2+)-binding protein S100A4, it acts as a chemoattractant that induces lymphocyte movement and activates lymphocytes to eliminate virus-infected and tumor cells. The induction of cytotoxicity on monocyte surfaces requires interaction with the TREM1 receptor. This protein exhibits a homodimeric structure linked by disulfide bonds and interacts intricately with HSPA1A and HSPBP1, modulating its cytotoxic activity. These versatile functions underscore the critical involvement of PGLYRP1/PGRP-S in immune response and defense mechanisms.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

O88593 (F19-E182)

Gene ID
Molecular Construction
N-term
PGLYRP1 (F19-E182)
Accession # O88593
His
C-term
Synonyms
Peptidoglycan recognition protein 1; Cytokine tag7; PGRP-S; Tag7; PGRP
AA Sequence

FIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE

Molecular Weight

Approximately 18 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PGLYRP1/PGRP-S Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PGLYRP1/PGRP-S Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76543
Quantity:
MCE Japan Authorized Agent: