1. Recombinant Proteins
  2. Others
  3. PITPNA Protein, Human (His)

PITPNA Protein catalyzes phosphatidylinositol (PI) and phosphatidylcholine (PC) transfer between membranes, displaying a preference for shorter saturated or monosaturated acyl chains at sn-1 and sn-2 positions. For PC, the preference order is C16:1 > C16:0 > C18:1 > C18:0 > C20:4, and for PI, it is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 > C20:3. PITPNA Protein, Human (His) is the recombinant human-derived PITPNA protein, expressed by E. coli , with N-6*His labeled tag. The total length of PITPNA Protein, Human (His) is 270 a.a., with molecular weight of 16 & 22 & 38 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PITPNA Protein catalyzes phosphatidylinositol (PI) and phosphatidylcholine (PC) transfer between membranes, displaying a preference for shorter saturated or monosaturated acyl chains at sn-1 and sn-2 positions. For PC, the preference order is C16:1 > C16:0 > C18:1 > C18:0 > C20:4, and for PI, it is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 > C20:3. PITPNA Protein, Human (His) is the recombinant human-derived PITPNA protein, expressed by E. coli , with N-6*His labeled tag. The total length of PITPNA Protein, Human (His) is 270 a.a., with molecular weight of 16 & 22 & 38 kDa, respectively.

Background

PITPNA protein functions as a catalyst in the transfer of phosphatidylinositol (PI) and phosphatidylcholine (PC) between cellular membranes. This enzyme exhibits a notable preference for PI and PC molecules that possess shorter saturated or monosaturated acyl chains at the sn-1 and sn-2 positions. The preference order for PC substrates is C16:1 > C16:0 > C18:1 > C18:0 > C20:4, while for PI substrates, it is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 > C20:3. The dynamic lipid transfer mediated by PITPNA contributes to the regulation of lipid composition in cellular membranes, influencing various cellular processes and maintaining membrane homeostasis.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q00169 (M1-D270)

Gene ID
Molecular Construction
N-term
6*His
PITPNA (M1-D270)
Accession # Q00169
C-term
Synonyms
Phosphatidylinositol Transfer Protein Alpha Isoform; PI-TP-Alpha; PtdIns Transfer Protein Alpha; PtdInsTP Alpha; PITPNA; PITPN
AA Sequence

MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD

Molecular Weight

16&22&38 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PITPNA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PITPNA Protein, Human (His)
Cat. No.:
HY-P71207
Quantity:
MCE Japan Authorized Agent: