PKI-beta Protein, Human (His)

The PKI-β protein emerged as an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity. This protein operates at the molecular level, binding to the catalytic subunit of the enzyme after cAMP induces dissociation of its regulatory chain. PKI-beta Protein, Human (His) is the recombinant human-derived PKI-beta protein, expressed by E. coli , with N-6*His labeled tag.

The PKI-beta protein is an exceptionally potent competitive inhibitor of cAMP-dependent protein kinase activity. Functioning as a regulatory molecule, PKI-beta exerts its inhibitory action by interacting with the catalytic subunit of the enzyme, particularly after the cAMP-induced dissociation of its regulatory chains. This regulatory mechanism underscores the dynamic nature of cAMP-dependent protein kinase activity and the pivotal role of PKI-beta in modulating this signaling pathway. By tightly regulating the catalytic subunit, PKI-beta plays a crucial role in modulating cellular responses to cAMP signaling, contributing to the fine-tuning of intracellular processes influenced by this important kinase, such as those related to cell growth, metabolism, and gene expression.

Human

E. coli

N-6*His

Q9C010-1 (M1-K78)

5570  [NCBI]

MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 20% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.