1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Plasma kallikrein/KLKB1 Protein, Rat (P.pastoris, His)

Plasma kallikrein/KLKB1 Protein, Rat (P.pastoris, His)

Cat. No.: HY-P71748
Handling Instructions Technical Support

Plasma kallikrein/KLKB1 enzymatically cleaves Lys-Arg and Arg-Ser bonds, triggering factor XII activation upon binding to a negatively charged surface.It liberates bradykinin from HMW kininogen and is implicated in the renin-angiotensin system, potentially converting prorenin into renin.This highlights the protein's multifaceted role in various physiological processes.Plasma kallikrein/KLKB1 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Plasma kallikrein/KLKB1 protein, expressed by P.pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Plasma kallikrein/KLKB1 enzymatically cleaves Lys-Arg and Arg-Ser bonds, triggering factor XII activation upon binding to a negatively charged surface.It liberates bradykinin from HMW kininogen and is implicated in the renin-angiotensin system, potentially converting prorenin into renin.This highlights the protein's multifaceted role in various physiological processes.Plasma kallikrein/KLKB1 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Plasma kallikrein/KLKB1 protein, expressed by P.pastoris , with N-6*His labeled tag.

Background

The Plasma kallikrein/KLKB1 protein exhibits enzymatic prowess, specifically cleaving Lys-Arg and Arg-Ser bonds. Upon binding to a negatively charged surface, it triggers a reciprocal activation of factor XII. Additionally, the protein facilitates the liberation of bradykinin from HMW kininogen. Notably, it is implicated in the renin-angiotensin system, potentially contributing to the conversion of prorenin into renin. This multifaceted functionality highlights the protein's involvement in diverse physiological processes.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Rat

Source

P. pastoris

Tag

N-6*His

Accession

P14272 (391I-638A)

Gene ID
Molecular Construction
N-term
6*His
KLKB1 (391I-638A)
Accession # P14272
C-term
Synonyms
Klkb1; Klk3; PkPlasma kallikrein; EC 3.4.21.34; Fletcher factor; Kininogenin
AA Sequence

IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA

Molecular Weight

Approximately 34 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Plasma kallikrein/KLKB1 Protein, Rat (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Plasma kallikrein/KLKB1 Protein, Rat (P.pastoris, His)
Cat. No.:
HY-P71748
Quantity:
MCE Japan Authorized Agent: