Plasma kallikrein/KLKB1 Protein, Rat (P.pastoris, His)

Plasma kallikrein/KLKB1 enzymatically cleaves Lys-Arg and Arg-Ser bonds, triggering factor XII activation upon binding to a negatively charged surface.It liberates bradykinin from HMW kininogen and is implicated in the renin-angiotensin system, potentially converting prorenin into renin.This highlights the protein's multifaceted role in various physiological processes.Plasma kallikrein/KLKB1 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Plasma kallikrein/KLKB1 protein, expressed by P.pastoris , with N-6*His labeled tag.

The Plasma kallikrein/KLKB1 protein exhibits enzymatic prowess, specifically cleaving Lys-Arg and Arg-Ser bonds. Upon binding to a negatively charged surface, it triggers a reciprocal activation of factor XII. Additionally, the protein facilitates the liberation of bradykinin from HMW kininogen. Notably, it is implicated in the renin-angiotensin system, potentially contributing to the conversion of prorenin into renin. This multifaceted functionality highlights the protein's involvement in diverse physiological processes.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Rat

P. pastoris

N-6*His

P14272 (391I-638A)

25048  [NCBI]

IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA

Approximately 34 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against solution in 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.