PPIH Protein, Human (His)

The PPIH protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of prolyl imide peptide bonds and may contribute to protein folding. It plays a crucial role in pre-mRNA splicing and contributes to the formation of the U4/U5/U6 tri-snRNP complex in spliceosome assembly. PPIH Protein, Human (His) is the recombinant human-derived PPIH protein, expressed by E. coli , with N-6*His labeled tag.

PPIH Protein functions as a peptidyl-prolyl cis-trans isomerase (PPIase), facilitating the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and potentially aiding in protein folding. Beyond its role in protein folding, PPIH actively participates in pre-mRNA splicing, suggesting involvement in the intricate process of spliceosome assembly. Specifically, it may contribute to the formation of the U4/U5/U6 tri-snRNP complex, a fundamental component of the spliceosome. This multifunctional role implies that PPIH may act as a chaperone, highlighting its versatile involvement in both protein folding and the regulation of essential cellular processes related to mRNA splicing. Further exploration is warranted to elucidate the specific molecular mechanisms and cellular contexts through which PPIH exerts its functions in protein homeostasis and pre-mRNA splicing.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

O43447-1 (M1-M177)

10465  [NCBI]

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Approximately 24.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.