1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Protease 7/OmpT Protein, E.coli (His-SUMO)

Protease 7, or OmpT, displays unique proteolytic capabilities, cleaving diverse substrates like T7 RNA polymerase, ferric enterobactin receptor protein (FEP), and protamine. With specificity for paired basic residues, it selectively targets substrates with such motifs, highlighting its pivotal role in diverse biological processes and protein regulation. Protease 7/OmpT Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Protease 7/OmpT protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Protease 7, or OmpT, displays unique proteolytic capabilities, cleaving diverse substrates like T7 RNA polymerase, ferric enterobactin receptor protein (FEP), and protamine. With specificity for paired basic residues, it selectively targets substrates with such motifs, highlighting its pivotal role in diverse biological processes and protein regulation. Protease 7/OmpT Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Protease 7/OmpT protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

Protease 7, also known as OmpT, showcases a distinct proteolytic capacity with the ability to cleave various substrates, including T7 RNA polymerase, ferric enterobactin receptor protein (FEP), antimicrobial peptide protamine, and several other proteins. This protease exhibits a notable specificity for paired basic residues, emphasizing its role in the selective cleavage of substrates with such structural motifs. The versatility of Protease 7/OmpT in targeting proteins with paired basic residues underscores its significance in diverse biological processes and protein regulation.

Species

E.coli

Source

E. coli

Tag

N-His;N-SUMO

Accession

P58603 (S21-F317)

Gene ID

913212  [NCBI]

Molecular Construction
N-term
6*His-SUMO
OmpT (S21-F317)
Accession # P58603
C-term
Synonyms
ompT; Z1931; ECs1663; Protease 7; EC 3.4.23.49; Omptin; Outer membrane protein 3B; Protease A; Protease VII
AA Sequence

STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPKGRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNRVTNKKGNTSLYDHNDNTSDYSKNGAGIENYNFITTAGLKYTF

Molecular Weight

Approximately 49.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Protease 7/OmpT Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Protease 7/OmpT Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71474
Quantity:
MCE Japan Authorized Agent: