Protein E7, HPV16 (His)

HPV protein E7 can induce dormant cells to enter the cell cycle and promote the efficient use of cellular DNA replication mechanisms for viral genome replication. Through translational and transactivation activities, E7 disrupts the RB1-E2F1 complex and activates E2F1-regulated S-phase genes. Protein E7, HPV16 (His) is the recombinant Virus-derived protein E7, HPV, expressed by E. coli , with N-6*His labeled tag.

The Protein E7 from Human Papillomavirus (HPV) plays a crucial role in viral genome replication by inducing quiescent cells to enter the cell cycle, facilitating the efficient utilization of the cellular DNA replicating machinery for viral genome replication. E7 exhibits both transforming and trans-activating activities, disrupting the RB1-E2F1 complex and activating E2F1-regulated S-phase genes. It interferes with host histone deacetylation mediated by HDAC1 and HDAC2, resulting in transcriptional activation. Additionally, E7 inhibits the antiviral and antiproliferative functions of host interferon alpha. Its interaction with host TMEM173/STING hinders the ability of TMEM173/STING to sense cytosolic DNA and promote type I interferon production. E7 forms homodimers and homooligomers, interacts with host RB1 to disrupt RB1 activity, and associates with EP300 to repress EP300 transcriptional activity. Complex formation with CHD4 and HDAC1 alters host histone deacetylation, while the interaction with protein E2 inhibits E7 oncogenic activity. The multifaceted actions of Protein E7 underscore its pivotal role in HPV-associated cellular processes and its intricate modulation of host cell functions.

Measured by its binding ability in a functional ELISA. Immobilized Protein E7 at 10 μg/mL (100 μL/well) can bind Biotinylated MYC. The ED₅₀ for this effect is ≤0.3071 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Protein E7 at 10 μg/mL (100 μL/well) can bind Biotinylated MYC. The ED₅₀ for this effect is 0.2398 μg/mL, corresponding to a specific activity is 4.17×10³ Unit/mg.

Virus

E. coli

N-6*His

P03129 (M1-P98)

1489079  [NCBI]

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Approximately 19-21 kDa

• 
  Greater than 94% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from 0.2 μm filtered solution in 20 mM Tris-HCL, 0.5 M NaCl, 6% Trehalose, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 or PBS, 6% Trehalose, pH 7.4 or 50 mM Tris-HCL, 200 mM NaCl, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.