1. Recombinant Proteins
  2. Others
  3. PRTFDC1 Protein, Human (His)

PRTFDC1 protein, with minimal phosphoribosyltransferase activity, shows low in vitro detection levels. It binds GMP, IMP, and PRPP, yet its involvement in purine metabolism or salvage is not expected. Functioning as a homodimer, its structural configuration highlights its role in cellular processes. PRTFDC1 Protein, Human (His) is the recombinant human-derived PRTFDC1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 35 In-stock
10 μg USD 60 In-stock
50 μg USD 170 In-stock
100 μg   Get quote  

Get it by tomorrow May 13 for select sizes. Order within 5 hrs 18 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRTFDC1 protein, with minimal phosphoribosyltransferase activity, shows low in vitro detection levels. It binds GMP, IMP, and PRPP, yet its involvement in purine metabolism or salvage is not expected. Functioning as a homodimer, its structural configuration highlights its role in cellular processes. PRTFDC1 Protein, Human (His) is the recombinant human-derived PRTFDC1 protein, expressed by E. coli , with N-His labeled tag.

Background

The PRTFDC1 protein demonstrates minimal phosphoribosyltransferase activity, with detection levels being notably low in vitro. It exhibits binding affinity towards GMP, IMP, and alpha-D-5-phosphoribosyl 1-pyrophosphate (PRPP). However, its role in purine metabolism or salvage is not anticipated. The protein functions as a homodimer, emphasizing its structural configuration in cellular processes.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9NRG1-1 (M1-V225)

Gene ID
Molecular Construction
N-term
His
PRTFDC1 (M1-V225)
Accession # Q9NRG1-1
C-term
Synonyms
Phosphoribosyltransferase domain-containing protein 1; HHGP
AA Sequence

MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV

Molecular Weight

Approximately 26 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PRTFDC1 Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRTFDC1 Protein, Human (His)
Cat. No.:
HY-P77158
Quantity:
MCE Japan Authorized Agent: