PSP Protein, Human (His)

PSP protein catalyzes the final irreversible step in carbohydrate biosynthesis of L-serine through dephosphorylation of O-phospho-L-serine. PSP Protein, Human (His) is the recombinant human-derived PSP protein, expressed by E. coli , with C-6*His labeled tag. The total length of PSP Protein, Human (His) is 225 a.a., with molecular weight of 25-30 kDa.

Phosphoserine phosphatase (PSP) is responsible for catalyzing the final irreversible step in the biosynthesis of L-serine from carbohydrates, involving the dephosphorylation of O-phospho-L-serine to L-serine. This enzymatic activity is pivotal for various cellular processes, as L-serine serves as a precursor for protein synthesis, the generation of other amino acids, nucleotide metabolism, and glutathione synthesis. Additionally, L-serine can undergo racemization to form D-serine, which functions as a neuromodulator. PSP's role in regulating the availability of L-serine underscores its significance in diverse metabolic pathways and cellular functions. There is also a potential involvement in the dephosphorylation of O-phospho-D-serine, although this aspect remains to be confirmed.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

C-6*His

P78330 (M1-E225)

5723  [NCBI]

MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

25-30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 4 M Urea, 5 mM EDTA, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.