PTS Protein, Human (His)

PTS proteins are critical in the biosynthesis of tetrahydrobiopterin, an important cofactor for aromatic amino acid hydroxylase. It catalyzes the conversion of 7,8-dihydroneopterin triphosphate to 6-pyruvoyltetrahydropterin, a key step in the biosynthetic pathway. PTS Protein, Human (His) is the recombinant human-derived PTS protein, expressed by E. coli , with N-His labeled tag. The total length of PTS Protein, Human (His) is 145 a.a., with molecular weight of ~17 kDa.

The PTS Protein plays a crucial role in the biosynthesis of tetrahydrobiopterin, a vital cofactor for aromatic amino acid hydroxylases. This enzyme is instrumental in catalyzing the transformation of 7,8-dihydroneopterin triphosphate into 6-pyruvoyl tetrahydropterin, a key step in the biosynthetic pathway. The catalytic activity of the PTS Protein underscores its significance in facilitating the conversion necessary for the production of tetrahydrobiopterin, essential for the proper functioning of aromatic amino acid hydroxylases.

Human

E. coli

N-His

Q03393 (M1-E145)

5805  [NCBI]

MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE

Approximately 17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 40% Glycerol, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.