1. Recombinant Proteins
  2. Others
  3. S100A5 Protein, Mouse (His)

S100A5 Protein, with versatile binding properties, interacts with calcium, zinc, and copper.Each subunit can bind two calcium ions or two copper ions along with one zinc ion.Calcium and copper ions compete for the same binding sites, revealing dynamic molecular interactions in S100A5.Structurally, the protein forms a homodimer, suggesting its dimeric form mediates functional activities in cellular processes.S100A5 Protein, Mouse (His) is the recombinant mouse-derived S100A5 protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A5 Protein, with versatile binding properties, interacts with calcium, zinc, and copper.Each subunit can bind two calcium ions or two copper ions along with one zinc ion.Calcium and copper ions compete for the same binding sites, revealing dynamic molecular interactions in S100A5.Structurally, the protein forms a homodimer, suggesting its dimeric form mediates functional activities in cellular processes.S100A5 Protein, Mouse (His) is the recombinant mouse-derived S100A5 protein, expressed by E.coli , with N-His labeled tag.

Background

The S100A5 Protein exhibits versatile binding properties, interacting with calcium, zinc, and copper. Each subunit has the capability to simultaneously bind either two calcium ions or two copper ions along with one zinc ion. Interestingly, calcium and copper ions compete for the same binding sites, indicating a dynamic interplay in the molecular interactions of S100A5. Structurally, the protein exists as a homodimer, with its dimeric form likely playing a role in mediating its functional activities in cellular processes.

Biological Activity

Measured in a cell proliferation assay using T24 cells. The ED50 for this effect is 13.14 ng/mL, corresponding to a specific activity is 7.61×104 units/mg.

  • Measured in a cell proliferation assay using T24 cells. The ED50 for this effect is 13.14 ng/mL, corresponding to a specific activity is 7.61×104 units/mg.
Species

Mouse

Source

E. coli

Tag

N-10*His

Accession

P63084 (M1-K93)

Gene ID
Molecular Construction
N-term
His
S100A5 (M1-K93)
Accession # P63084
C-term
Synonyms
Protein S100-A5; Protein S-100D; S100 calcium-binding protein A5
AA Sequence

METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKTELSLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDNK

Molecular Weight

Approximately 13 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100A5 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A5 Protein, Mouse (His)
Cat. No.:
HY-P76018
Quantity:
MCE Japan Authorized Agent: