1. Recombinant Proteins
  2. Others
  3. SH3PXD2A Protein, Human (Myc, His)

SH3PXD2A is an adapter protein that plays a crucial role in the formation of invadopodia and podosomes, thereby enhancing the invasiveness of cancer cells. It interacts with ADAM, NOX and phosphoinositides and contributes to a variety of cellular processes. SH3PXD2A Protein, Human (Myc, His) is the recombinant human-derived SH3PXD2A protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of SH3PXD2A Protein, Human (Myc, His) is 85 a.a., with molecular weight of ~14.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SH3PXD2A is an adapter protein that plays a crucial role in the formation of invadopodia and podosomes, thereby enhancing the invasiveness of cancer cells. It interacts with ADAM, NOX and phosphoinositides and contributes to a variety of cellular processes. SH3PXD2A Protein, Human (Myc, His) is the recombinant human-derived SH3PXD2A protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of SH3PXD2A Protein, Human (Myc, His) is 85 a.a., with molecular weight of ~14.0 kDa.

Background

SH3PXD2A, functioning as an adapter protein, plays a pivotal role in the formation of invadopodia and podosomes, contributing to extracellular matrix degradation and enhancing the invasiveness of certain cancer cells. This multifaceted protein establishes connections with matrix metalloproteinases (ADAMs), NADPH oxidases (NOXs), and phosphoinositides, thereby participating in diverse cellular processes. Acting as an organizer protein, SH3PXD2A facilitates NOX1- or NOX3-dependent reactive oxygen species (ROS) generation and ensures precise ROS localization. In collaboration with ADAM12, it mediates the neurotoxic effects induced by amyloid-beta peptide. The protein further interacts with CYBA, ADAM15, ADAM19, NOXO1, and NOXA1, forming a complex network of molecular associations. Notably, its interaction with FASLG underscores its involvement in intricate cellular signaling pathways.

Species

Human

Source

E. coli

Tag

N-His;C-Myc

Accession

Q5TCZ1 (902P-986P)

Gene ID
Molecular Construction
N-term
10*His
SH3PXD2A (902P-986P)
Accession # Q5TCZ1
Myc
C-term
Synonyms
Adapter protein TKS5; Five SH3 domain-containing protein; SH3 and PX domain-containing protein 2A; SH3 multiple domains protein 1; Sh3md1; Sh3pxd2a; SPD2A_HUMAN; TKs5; Tyrosine kinase substrate with five SH3 domains
AA Sequence

PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SH3PXD2A Protein, Human (Myc, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SH3PXD2A Protein, Human (Myc, His)
Cat. No.:
HY-P71572
Quantity:
MCE Japan Authorized Agent: