SH3PXD2A Protein, Human (Myc, His)

SH3PXD2A is an adapter protein that plays a crucial role in the formation of invadopodia and podosomes, thereby enhancing the invasiveness of cancer cells. It interacts with ADAM, NOX and phosphoinositides and contributes to a variety of cellular processes. SH3PXD2A Protein, Human (Myc, His) is the recombinant human-derived SH3PXD2A protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of SH3PXD2A Protein, Human (Myc, His) is 85 a.a., with molecular weight of ~14.0 kDa.

SH3PXD2A, functioning as an adapter protein, plays a pivotal role in the formation of invadopodia and podosomes, contributing to extracellular matrix degradation and enhancing the invasiveness of certain cancer cells. This multifaceted protein establishes connections with matrix metalloproteinases (ADAMs), NADPH oxidases (NOXs), and phosphoinositides, thereby participating in diverse cellular processes. Acting as an organizer protein, SH3PXD2A facilitates NOX1- or NOX3-dependent reactive oxygen species (ROS) generation and ensures precise ROS localization. In collaboration with ADAM12, it mediates the neurotoxic effects induced by amyloid-beta peptide. The protein further interacts with CYBA, ADAM15, ADAM19, NOXO1, and NOXA1, forming a complex network of molecular associations. Notably, its interaction with FASLG underscores its involvement in intricate cellular signaling pathways.

Human

E. coli

N-His;C-Myc

Q5TCZ1 (902P-986P)

9644  [NCBI]

PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP

Approximately 14.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.