SLC30A8 Protein, Mouse (Cell-Free, His)

SLC30A8 Protein, a proton-coupled zinc ion antiporter, crucially regulates insulin secretion. Serving as a mediator, SLC30A8 enables zinc entry into pancreatic beta cell secretory granules, maintaining the required zinc concentration. This process finely tunes insulin release dynamics, emphasizing SLC30A8's pivotal role in physiological insulin secretion control and glucose homeostasis. SLC30A8 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived SLC30A8 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of SLC30A8 Protein, Mouse (Cell-Free, His) is 367 a.a., with molecular weight of 43.0&86 kDa.

SLC30A8 Protein, identified as a proton-coupled zinc ion antiporter, plays a pivotal role in the intricate regulation of insulin secretion. Functioning as a mediator, SLC30A8 facilitates the entry of zinc into the lumen of pancreatic beta cell secretory granules. This process is crucial for maintaining the appropriate zinc concentration within the granules, ultimately influencing the dynamics of insulin release. By participating in the transport of zinc, SLC30A8 contributes to the finely tuned orchestration of cellular events within pancreatic beta cells, highlighting its significance in the physiological control of insulin secretion and, consequently, glucose homeostasis.

Mouse

E. coli Cell-free

N-10*His

Q8BGG0 (M1-D367)

239436

MEFLERTYLVNDQATKMYAFPLDRELRQKPVNKDQCPGDRPEHPEAGGIYHCHNSAKATGNRSSKQAHAKWRLCAASAICFIFMVAEVVGGHVAGSLAILTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLLYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTMILHQRNFGYNHKDVQANASVRAAFVHALGDVFQSISVLISALIIYFKPDYKIADPVCTFIFSILVLASTVMILKDFSILLMEGVPKGLSYNSVKEIILAVDGVISVHSLHIWSLTVNQVILSVHVATAASQDSQSVRTGIAQALSSFDLHSLTIQIESAADQDPSCLLCEDPQD

Monomer: 43 kDa Dimer: 86 kDa It is speculated that the protein forms a dimeric structure.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 20 mM Tris-HCl, 0.15M NaCl, 0.05%BRIJ-78, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.