SNCA Protein, Human (His)

Alpha-synuclein (SNCA) is a key neuronal protein that regulates synaptic activity, including vesicle transport and neurotransmitter release. As a monomer, it enhances vesicle exocytosis, promotes fusion and fusion pore expansion, and increases local Ca(2+) release. SNCA Protein, Human (His) is the recombinant human-derived SNCA protein, expressed by E. coli , with N-6*His labeled tag. The total length of SNCA Protein, Human (His) is 140 a.a., with molecular weight of ~18.0 kDa.

alpha-Synuclein (SNCA), a pivotal neuronal protein, orchestrates diverse roles in synaptic activity, including the regulation of synaptic vesicle trafficking and neurotransmitter release. As a monomer, it actively participates in synaptic vesicle exocytosis, enhancing vesicle priming, fusion, and dilation of exocytotic fusion pores, and mechanistically increases local Ca(2+) release from microdomains, crucial for ATP-induced exocytosis. In its multimeric membrane-bound state, SNCA functions as a molecular chaperone, assisting in the folding of synaptic fusion components (SNAREs) at the presynaptic plasma membrane, a process vital for maintaining normal SNARE-complex assembly during aging. SNCA also plays a crucial role in regulating dopamine neurotransmission by interacting with the dopamine transporter (DAT1) and modulating its activity. Existing as both a soluble monomer and homotetramer, a dynamic intracellular population of tetramers and monomers coexists, with the tetramer playing an essential role in maintaining homeostasis. SNCA engages in a complex network of interactions with proteins such as UCHL1, synphilin-1/SNCAIP, CALM1, STXBP1, VAMP2, SNAP25, RPH3A, RAB3A, SERF1A, and SEPTIN4, highlighting its involvement in intricate molecular processes governing synaptic function and integrity.

Immobilized SNCA at 1 μg/mL (100 μL/well) can bind SNCA Antibody , The ED₅₀ for this effect is 6.552-7.551 ng/mL.

Human

E. coli

N-6*His

P37840-1 (M1-A140)

6622  [NCBI]

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Approximately 18.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of sterile 20 mM PB, 150 mM NaCl, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.