1. Recombinant Proteins
  2. Others
  3. SPEB Protein, E.coli (His-SUMO)

The SPEB protein plays a central role in cellular processes as it catalyzes the formation of putrescine from agmatine. This enzyme activity is essential for the biosynthesis of putrescine, a polyamine with important functions in cell growth, proliferation, and various physiological processes. SPEB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived SPEB protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 182 In-stock
10 μg USD 309 In-stock
50 μg USD 865 In-stock
100 μg   Get quote  

Get it by May 1 for select sizes. Order within 17 hrs 40 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SPEB protein plays a central role in cellular processes as it catalyzes the formation of putrescine from agmatine. This enzyme activity is essential for the biosynthesis of putrescine, a polyamine with important functions in cell growth, proliferation, and various physiological processes. SPEB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived SPEB protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

SPEB, or agmatine ureohydrolase, is an enzyme that catalyzes the formation of putrescine from agmatine. This enzymatic reaction is a crucial step in the biosynthetic pathway of polyamines. Putrescine is a diamine that serves as a precursor for the synthesis of higher polyamines, such as spermidine and spermine, which are essential for various cellular processes, including cell growth, differentiation, and nucleic acid stabilization. By converting agmatine into putrescine, SPEB plays a central role in regulating polyamine levels, influencing cellular functions critical for growth and development. It has to succinctly outline SPEB's specific catalytic activity in the biosynthesis of putrescine, emphasizing its importance in the polyamine metabolic pathway.

Species

E.coli

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

B7LFJ6 (M1-E306)

Gene ID

/

Molecular Construction
N-term
6*His-SUMO
SPEB (M1-E306)
Accession # B7LFJ6
C-term
Synonyms
speB; EC55989_3229; Agmatinase; EC 3.5.3.11; Agmatine ureohydrolase; AUH
AA Sequence

MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDIDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKKGE

Molecular Weight

Approximately 49.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SPEB Protein, E.coli (His-SUMO) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPEB Protein, E.coli (His-SUMO)
Cat. No.:
HY-P72072
Quantity:
MCE Japan Authorized Agent: