1. Recombinant Proteins
  2. Others
  3. ssPA Protein, E. coli (His)

The ssPA protein specifically forms an equimolar complex with RNA polymerase holoenzyme (RNAP), thereby distinguishing its interaction preference from the core enzyme. ssPA is primarily synthesized during amino acid starvation and accounts for more than 50% of the total protein produced under these conditions. ssPA Protein, E. coli (His) is the recombinant E. coli-derived ssPA protein, expressed by E. coli , with N-His labeled tag. The total length of ssPA Protein, E. coli (His) is 212 a.a., with molecular weight of ~25 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ssPA protein specifically forms an equimolar complex with RNA polymerase holoenzyme (RNAP), thereby distinguishing its interaction preference from the core enzyme. ssPA is primarily synthesized during amino acid starvation and accounts for more than 50% of the total protein produced under these conditions. ssPA Protein, E. coli (His) is the recombinant E. coli-derived ssPA protein, expressed by E. coli , with N-His labeled tag. The total length of ssPA Protein, E. coli (His) is 212 a.a., with molecular weight of ~25 kDa.

Background

The ssPA (stringent starvation protein A) forms an equimolar complex with the RNA polymerase holoenzyme (RNAP) but does not associate with the core enzyme. Synthesized predominantly during amino acid starvation, ssPA constitutes over 50% of the total protein synthesized under such conditions. Its role is crucial in orchestrating the transition from P1 early to P1 late gene expression, suggesting its involvement in regulating gene expression during specific cellular states. Remarkably, the functional interchangeability observed between Rnk and SspA with the Pseudomonas aeruginosa alginate regulatory gene algR2 underscores the regulatory versatility of ssPA-like proteins in bacterial systems.

Species

E.coli

Source

E. coli

Tag

N-His

Accession

P0ACA3 (M1-S212)

Gene ID

61751941

Molecular Construction
N-term
His
ssPA (M1-S212)
Accession # P0ACA3
C-term
Synonyms
Stringent starvation protein A; sspA; pog; ssp
AA Sequence

MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMHRIEKDWYTLMNTIINGSASEADAARKQLREELLAIAPVFGQKPYFLSDEFSLVDCYLAPLLWRLPQLGIEFSGPGAKELKGYMTRVFERDSFLASLTEAEREMRLGRS

Molecular Weight

Approximately 25 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ssPA Protein, E. coli (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ssPA Protein, E. coli (His)
Cat. No.:
HY-P76089
Quantity:
MCE Japan Authorized Agent: