SUMF1 Protein, Human (HEK293, His)

The SUMF1 protein plays an important role as an oxidase that converts cysteine to 3-oxoalanine on specific target proteins such as GALNS, ARSA, STS, and ARSE. This enzymatic activity is essential for the maturation of arylsulfatase and alkaline phosphatase, leading to the formation of 3-oxoalanine (fGly). SUMF1 Protein, Human (HEK293, His) is the recombinant human-derived SUMF1 protein, expressed by HEK293 , with C-6*His labeled tag.

SUMF1 Protein functions as an oxidase, facilitating the conversion of cysteine to 3-oxoalanine on specific target proteins, a process involving molecular oxygen and an unidentified reducing agent. This enzymatic activity is crucial for the maturation of arylsulfatases and some alkaline phosphatases, leading to the formation of 3-oxoalanine, also known as formylglycine (fGly). Notable substrates for SUMF1 include GALNS, ARSA, STS, and ARSE, highlighting its role in the modification of key proteins involved in various biological processes.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

Q8NBK3-1 (S34-D374)

285362  [NCBI]

SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD

38-42 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 2 mM CaCl₂, 10% Glycerol, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.