1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. SUMF1 Protein, Human (HEK293, His)

The SUMF1 protein plays an important role as an oxidase that converts cysteine to 3-oxoalanine on specific target proteins such as GALNS, ARSA, STS, and ARSE. This enzymatic activity is essential for the maturation of arylsulfatase and alkaline phosphatase, leading to the formation of 3-oxoalanine (fGly). SUMF1 Protein, Human (HEK293, His) is the recombinant human-derived SUMF1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SUMF1 protein plays an important role as an oxidase that converts cysteine to 3-oxoalanine on specific target proteins such as GALNS, ARSA, STS, and ARSE. This enzymatic activity is essential for the maturation of arylsulfatase and alkaline phosphatase, leading to the formation of 3-oxoalanine (fGly). SUMF1 Protein, Human (HEK293, His) is the recombinant human-derived SUMF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

SUMF1 Protein functions as an oxidase, facilitating the conversion of cysteine to 3-oxoalanine on specific target proteins, a process involving molecular oxygen and an unidentified reducing agent. This enzymatic activity is crucial for the maturation of arylsulfatases and some alkaline phosphatases, leading to the formation of 3-oxoalanine, also known as formylglycine (fGly). Notable substrates for SUMF1 include GALNS, ARSA, STS, and ARSE, highlighting its role in the modification of key proteins involved in various biological processes.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8NBK3-1 (S34-D374)

Gene ID
Molecular Construction
N-term
SUMF1 (S34-D374)
Accession # Q8NBK3-1
6*His
C-term
Synonyms
Sulfatase-Modifying Factor 1; C-Alpha-Formylglycine-Generating Enzyme 1; SUMF1; FGE
AA Sequence

SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD

Molecular Weight

38-42 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 2 mM CaCl2, 10% Glycerol, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SUMF1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SUMF1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71345
Quantity:
MCE Japan Authorized Agent: