TNF-alpha/TNFSF2 Protein, Mouse (His)

TNF-alpha/TNFSF2 Protein, Mouse (His) is recombinant mouse tumor necrosis factor alpha (TNF-α) with his tag.TNF-alpha/TNFSF2 Protein, a major mediator of inflammation, is involved in a number of infectious and parasitic diseases.

Tumor necrosis factor-α (TNF-α) is a pleiotropic cytokine produced by a wide variety of cell types of mostly hematopoietic, but also of nonhematopoietic, origin. TNFα is instrumental in the immune elimination of various infectious agents such as Candida albicans, Listeria monocytogenes, or mycobacteria and exerts potent proinflammatory effects, e.g. by inducing the expression of adhesion molecules such as VCAM-1, intercellular adhesion molecule 1 (ICAM-1), or E-selectin on endothelial cells and other cell types^[1][2].

The ED₅₀ is ≤0.06 ng/mL as measured by L-929 mouse fibrosarcoma cells, corresponding to a specific activity of ≥1.7 × 10⁷ units/mg.

• 
  The ED₅₀ is <0.05 ng/mL as measured by L-929 mouse fibrosarcoma cells, corresponding to a specific activity of >2 × 10⁷ units/mg.

Mouse

E. coli

N-His

P06804 (L80-L235)

21926  [NCBI]

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Approximately 18.3 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS or 20 mM PB, 150 mM NaCl, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose,5% mannitol and 0.01% Tween80.

<1.0 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. de Kossodo S, et al. Tumor necrosis factor alpha is involved in mouse growth and lymphoid tissue development. J Exp Med. 1992 Nov 1;176(5):1259-64.  [Content Brief]

  [2]. Mueller C, et al. Noncleavable transmembrane mouse tumor necrosis factor-alpha (TNFalpha) mediates effectsdistinct from those of wild-type TNFalpha in vitro and in vivo. J Biol Chem. 1999 Dec 31;274(53):38112-8.  [Content Brief]