TREM-2 Protein, Cynomolgus (HEK293, His)

TREM-2 protein forms a signaling complex with TYROBP, activates cells upon ligand binding, and acts as a receptor for amyloid beta, lipoproteins, and apolipoproteins. It promotes their uptake by microglia, triggering activation, proliferation, migration, apoptosis and cytokine expression. TREM-2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TREM-2 protein, expressed by HEK293 , with C-6*His labeled tag.

TREM-2 Protein forms a receptor signaling complex with TYROBP, mediating signaling and cell activation upon ligand binding. It acts as a receptor for amyloid-beta protein 42, facilitating its uptake and degradation by microglia, resulting in microglial activation, proliferation, migration, apoptosis, and cytokine expression. Additionally, TREM-2 serves as a receptor for lipoprotein particles and apolipoproteins, enhancing their uptake in microglia. It binds phospholipids and regulates microglial proliferation, phagocytosis of apoptotic neurons, and response to oxidative stress. Furthermore, TREM-2 suppresses PI3K and NF-kappa-B signaling, promotes anti-apoptotic NF-kappa-B signaling during oxidative stress, and plays a role in microglial MTOR activation and metabolism. It is involved in age-related changes in microglial numbers and triggers immune responses in macrophages and dendritic cells. TREM-2 also mediates cytokine-induced multinucleated giant cell formation and is implicated in osteoclast differentiation. The protein interacts with TYROBP, and this interaction is crucial for stabilizing the TREM-2 C-terminal fragment.

Cynomolgus

HEK293

C-6*His

XP_005553122.1 (H19-S174)

102133279  [NCBI]

HNTTVFQGVEGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRRNGSTAITDDTLGGTLTITLRNLQPHDAGFYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWVPGESESFEDAHVEHSISRSLLEGEIPFPPTS

28-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.