TROP-2 Protein, Human (248a.a, HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (248a.a, HEK293, His) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TROP-2 Protein, Human (248a.a, HEK293, His) is 248 a.a., with molecular weight of 38-55 kDa.

The TROP-2 protein emerges as a potential growth factor receptor, suggesting its involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth, proliferation, and potentially other cellular functions. The specific ligands and downstream pathways associated with TROP-2-mediated growth factor signaling remain areas for further investigation. Unraveling the detailed molecular mechanisms and functional implications of TROP-2 in growth factor signaling will contribute to a comprehensive understanding of its role in cellular physiology and may open avenues for therapeutic interventions targeting this receptor.

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5x10⁴ cells/well are added to Recombinant Human TROP-2 coated plates (10 µg/mL with 100 µL/well), 27.55% cells will adhere after 1 hour incubation.

Human

HEK293

C-6*His

P09758 (H27-T274)

4070  [NCBI]

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

38-55 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.