TUBB4A Protein, Human (His)

TUBB4A protein, the main constituent of microtubules, forms cylindrical structures via lateral association of alpha- and beta-tubulin protofilaments. Microtubule growth, facilitated by GTP-tubulin dimers, leads to a stabilizing cap. Below this, TUBB4A dimers transition to a GDP-bound state, regulated by alpha-tubulin's GTPase activity. This intricate mechanism highlights TUBB4A's crucial role in governing microtubule assembly and stability. TUBB4A Protein, Human (His) is the recombinant human-derived TUBB4A protein, expressed by E. coli , with N-6*His labeled tag. The total length of TUBB4A Protein, Human (His) is 444 a.a., with molecular weight of ~58.0 kDa.

The TUBB4A protein takes center stage as the primary component of microtubules, contributing to the formation of cylindrical structures through the lateral association of linear protofilaments composed of alpha- and beta-tubulin heterodimers. The dynamic growth of microtubules is facilitated by the addition of GTP-tubulin dimers to the microtubule end, resulting in the formation of a stabilizing cap. Below this cap, TUBB4A protein dimers transition to a GDP-bound state, a process regulated by the GTPase activity of alpha-tubulin. This intricate mechanism underscores the crucial role of TUBB4A in governing the assembly and stability of microtubules.

Human

E. coli

N-6*His

P04350 (M1-A444)

10382  [NCBI]

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA

Approximately 58.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.