1. Recombinant Proteins
  2. Others
  3. TUBB4A Protein, Human (His)

TUBB4A protein, the main constituent of microtubules, forms cylindrical structures via lateral association of alpha- and beta-tubulin protofilaments. Microtubule growth, facilitated by GTP-tubulin dimers, leads to a stabilizing cap. Below this, TUBB4A dimers transition to a GDP-bound state, regulated by alpha-tubulin's GTPase activity. This intricate mechanism highlights TUBB4A's crucial role in governing microtubule assembly and stability. TUBB4A Protein, Human (His) is the recombinant human-derived TUBB4A protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TUBB4A protein, the main constituent of microtubules, forms cylindrical structures via lateral association of alpha- and beta-tubulin protofilaments. Microtubule growth, facilitated by GTP-tubulin dimers, leads to a stabilizing cap. Below this, TUBB4A dimers transition to a GDP-bound state, regulated by alpha-tubulin's GTPase activity. This intricate mechanism highlights TUBB4A's crucial role in governing microtubule assembly and stability. TUBB4A Protein, Human (His) is the recombinant human-derived TUBB4A protein, expressed by E. coli , with N-6*His labeled tag.

Background

The TUBB4A protein takes center stage as the primary component of microtubules, contributing to the formation of cylindrical structures through the lateral association of linear protofilaments composed of alpha- and beta-tubulin heterodimers. The dynamic growth of microtubules is facilitated by the addition of GTP-tubulin dimers to the microtubule end, resulting in the formation of a stabilizing cap. Below this cap, TUBB4A protein dimers transition to a GDP-bound state, a process regulated by the GTPase activity of alpha-tubulin. This intricate mechanism underscores the crucial role of TUBB4A in governing the assembly and stability of microtubules.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P04350 (M1-A444)

Gene ID
Molecular Construction
N-term
6*His
TUBB4A (M1-A444)
Accession # P04350
C-term
Synonyms
Tubulin Beta-4A Chain; Tubulin 5 Beta; Tubulin Beta-4 Chain; TUBB4A; TUBB4; TUBB5
AA Sequence

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA

Molecular Weight

Approximately 58.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TUBB4A Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TUBB4A Protein, Human (His)
Cat. No.:
HY-P71075
Quantity:
MCE Japan Authorized Agent: