1. Recombinant Proteins
  2. Others
  3. PLAU/uPA Protein, Human (411a.a, HEK293, His, solution)

PLAU/uPA Protein, Human (411a.a, HEK293, His, solution)

Cat. No.: HY-P71050
SDS COA Handling Instructions Technical Support

uPA chain A Protein, a key player in the plasminogen activation system, selectively cleaves plasminogen, initiating fibrinolysis and contributing to tissue remodeling. Its precision underscores its role in regulating proteolytic activity, emphasizing its significance in the cascade of events leading to fibrinolysis and extracellular matrix remodeling in various physiological processes. PLAU/uPA Protein, Human (411a.a, HEK293, His, solution) is the recombinant human-derived PLAU/uPA protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

uPA chain A Protein, a key player in the plasminogen activation system, selectively cleaves plasminogen, initiating fibrinolysis and contributing to tissue remodeling. Its precision underscores its role in regulating proteolytic activity, emphasizing its significance in the cascade of events leading to fibrinolysis and extracellular matrix remodeling in various physiological processes. PLAU/uPA Protein, Human (411a.a, HEK293, His, solution) is the recombinant human-derived PLAU/uPA protein, expressed by HEK293 , with C-6*His labeled tag.

Background

uPA chain A, a key player in the plasminogen activation system, performs a critical role as it selectively cleaves the zymogen plasminogen to generate the enzymatically active form known as plasmin. This proteolytic activation is a pivotal step in fibrinolysis, where plasmin functions to degrade fibrin clots and contribute to tissue remodeling and repair. uPA chain A's precision in cleaving plasminogen underscores its significance in regulating the delicate balance of proteolytic activity, emphasizing its role as a key initiator in the cascade of events leading to fibrinolysis and other physiological processes involving extracellular matrix remodeling.

Biological Activity

Measured by its ability to cleave a peptide substrate, N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC). Read at excitation and emission wavelengths of 380 nm and 460 nm (top read). The specific activity is 1120.66 pmol/min/µg, as measured under the described conditions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P00749-1 (S21-L431)

Gene ID
Molecular Construction
N-term
PLAU (S21-L431)
Accession # P00749-1
6*His
C-term
Synonyms
Urokinase-Type Plasminogen Activator; U-Plasminogen Activator; uPA; PLAU
AA Sequence

SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Molecular Weight

45-55 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM HEPES, 2 mM CaCl2, 10% Glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PLAU/uPA Protein, Human (411a.a, HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLAU/uPA Protein, Human (411a.a, HEK293, His, solution)
Cat. No.:
HY-P71050
Quantity:
MCE Japan Authorized Agent: