1. Recombinant Proteins
  2. Others
  3. VIPR2 Protein, Human (HEK293, Fc)

VIPR2 protein, serving as a receptor for Vasoactive Intestinal Peptide (VIP) and Pituitary Adenylate Cyclase-Activating Peptide (PACAP-38 and -27), activates adenylyl cyclase and can also couple with phospholipase C. Its versatile signaling pathways emphasize its pivotal role in transducing signals from VIP and PACAP, participating in cellular processes regulated by cyclic AMP and phosphoinositide signaling cascades. VIPR2 Protein, Human (HEK293, Fc) is the recombinant human-derived VIPR2 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of VIPR2 Protein, Human (HEK293, Fc) is 103 a.a., with molecular weight of 45-60 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VIPR2 protein, serving as a receptor for Vasoactive Intestinal Peptide (VIP) and Pituitary Adenylate Cyclase-Activating Peptide (PACAP-38 and -27), activates adenylyl cyclase and can also couple with phospholipase C. Its versatile signaling pathways emphasize its pivotal role in transducing signals from VIP and PACAP, participating in cellular processes regulated by cyclic AMP and phosphoinositide signaling cascades. VIPR2 Protein, Human (HEK293, Fc) is the recombinant human-derived VIPR2 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of VIPR2 Protein, Human (HEK293, Fc) is 103 a.a., with molecular weight of 45-60 kDa.

Background

The VIPR2 protein functions as a receptor for Vasoactive Intestinal Peptide (VIP) as well as Pituitary Adenylate Cyclase-Activating Peptide (PACAP-38 and -27). The receptor's activity is mediated by G proteins, leading to the activation of adenylyl cyclase. Additionally, VIPR2 exhibits the capability to couple with phospholipase C, showcasing its versatility in signaling pathways. These interactions highlight the pivotal role of VIPR2 in transducing signals from VIP and PACAP, thereby participating in cellular processes regulated by cyclic AMP and phosphoinositide signaling cascades.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

P41587 (E24-V126)

Gene ID
Molecular Construction
N-term
VIPR2 (E24-V126)
Accession # P41587
mFc
C-term
Synonyms
Vasoactive intestinal polypeptide receptor 2; VIP-R-2; PACAP-R3; VPAC2; VIPR2
AA Sequence

ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILV

Molecular Weight

45-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VIPR2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VIPR2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76128
Quantity:
MCE Japan Authorized Agent: