VIPR2 Protein, Human (HEK293, Fc)

VIPR2 protein, serving as a receptor for Vasoactive Intestinal Peptide (VIP) and Pituitary Adenylate Cyclase-Activating Peptide (PACAP-38 and -27), activates adenylyl cyclase and can also couple with phospholipase C. Its versatile signaling pathways emphasize its pivotal role in transducing signals from VIP and PACAP, participating in cellular processes regulated by cyclic AMP and phosphoinositide signaling cascades. VIPR2 Protein, Human (HEK293, Fc) is the recombinant human-derived VIPR2 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of VIPR2 Protein, Human (HEK293, Fc) is 103 a.a., with molecular weight of 45-60 kDa.

The VIPR2 protein functions as a receptor for Vasoactive Intestinal Peptide (VIP) as well as Pituitary Adenylate Cyclase-Activating Peptide (PACAP-38 and -27). The receptor's activity is mediated by G proteins, leading to the activation of adenylyl cyclase. Additionally, VIPR2 exhibits the capability to couple with phospholipase C, showcasing its versatility in signaling pathways. These interactions highlight the pivotal role of VIPR2 in transducing signals from VIP and PACAP, thereby participating in cellular processes regulated by cyclic AMP and phosphoinositide signaling cascades.

Human

HEK293

C-mFc

P41587 (E24-V126)

7434  [NCBI]

ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILV

45-60 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.