1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. VISTA
  5. VISTA/B7-H5 Protein, Mouse (159a.a, HEK293, His)

VISTA/B7-H5 Protein, Mouse (159a.a, HEK293, His)

Cat. No.: HY-P72428
Handling Instructions Technical Support

VISTA/B7-H5 Protein is a type I transmembrane protein expressed primarily in white blood cells that inhibits T cell function. VISTA/B7-H5 Protein promotes embryonic stem cell differentiation by inhibiting BMP4 signaling and stimulates MMP14 mediated MMP2 activation. VISTA/B7-H5 Protein is highly expressed in tumors. VISTA/B7-H5 Protein, Mouse (159a.a, HEK293, His) is the recombinant mouse-derived VISTA/B7-H5 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VISTA/B7-H5 Protein, Mouse (159a.a, HEK293, His) is 159 a.a., with molecular weight of 30-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VISTA/B7-H5 Protein is a type I transmembrane protein expressed primarily in white blood cells that inhibits T cell function. VISTA/B7-H5 Protein promotes embryonic stem cell differentiation by inhibiting BMP4 signaling and stimulates MMP14 mediated MMP2 activation. VISTA/B7-H5 Protein is highly expressed in tumors. VISTA/B7-H5 Protein, Mouse (159a.a, HEK293, His) is the recombinant mouse-derived VISTA/B7-H5 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VISTA/B7-H5 Protein, Mouse (159a.a, HEK293, His) is 159 a.a., with molecular weight of 30-40 kDa.

Background

VISTA is a type I transmembrane protein that functions as an immune checkpoint. VISTA is a member of the B7 family and is mainly expressed in white blood cells, whose transcription is partially controlled by p53. VISTA can act as a ligand and receptor of T cells, inhibit T cell effector function, and maintain peripheral tolerance. VISTA promotes embryonic stem cell differentiation by inhibiting BMP4 signaling. VISTA stimulates MMP14 mediated MMP2 activation. VISTA is produced at high levels in tumor-infiltrating lymphocytes, and blocking VISTA with antibodies led to delayed tumor growth in mouse models of melanoma and squamous cell carcinoma. Increased VISTA levels were associated with increased immune activation and a decrease in CD4-positive T cells[1][2][3][4][5][6].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9D659 (F33-A191)

Gene ID
Molecular Construction
N-term
VISTA (F33-A191)
Accession # Q9D659
6*His
C-term
Synonyms
V-type immunoglobulin domain-containing suppressor of T-cell activation; Vsir; Dies1; PD-1H; VISTA
AA Sequence

FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA

Molecular Weight

30-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VISTA/B7-H5 Protein, Mouse (159a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VISTA/B7-H5 Protein, Mouse (159a.a, HEK293, His)
Cat. No.:
HY-P72428
Quantity:
MCE Japan Authorized Agent: