VLDLR Protein, Human (HEK293, His)

VLDLR protein, a versatile receptor, mediates energy metabolism by binding and transporting VLDL into cells. It interacts with Reelin/RELN, APOE-containing ligands, and clusterin/CLU. Inactive VLDLR forms oligomers with LRP8, but upon ligand binding, it rearranges to transmit the extracellular RELN signal via DAB1 phosphorylation, regulating neuron positioning. VLDLR also acts as a stop signal for migrating neurons and serves as a receptor for Semliki Forest virus during microbial infection. VLDLR Protein, Human (HEK293, His) is the recombinant human-derived VLDLR protein, expressed by HEK293, with C-His labeled tag. The total length of VLDLR Protein, Human (HEK293, His) is 770 a.a., with molecular weight (glycosylation form) of 110-130 kDa.

VLDLR protein, a multifunctional cell surface receptor, plays a pivotal role in energy metabolism by binding to VLDL and facilitating its endocytic transport into cells. Beyond lipid transport, VLDLR exhibits versatile binding capabilities, interacting with a diverse array of molecules, including Reelin/RELN, apolipoprotein E/APOE-containing ligands, and clusterin/CLU. In its inactive state, VLDLR forms homooligomers or heterooligomers with LRP8. Upon ligand binding, homooligomers undergo rearrangement into higher order receptor clusters that transmit the extracellular RELN signal to intracellular signaling pathways by binding to DAB1. This interaction triggers the phosphorylation of DAB1, orchestrating the cellular responses necessary for the accurate positioning of newly generated neurons. Subsequently, VLDLR acts as a stop signal for migrating neurons, preventing their entry into the marginal zone. Notably, in the context of microbial infection, VLDLR serves as a receptor for Semliki Forest virus.

Human VLDLR, His Tag immobilized on CM5 Chip can bind Human PCSK9, His Tag with an affinity constant of ≤0.72 nM as determined in SPR assay (Biacore T200).

Human

HEK293

C-His

P98155 (G28--S797)

7436  [NCBI]

GRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVDGSDEKNCVKKTCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPDEFTCSSGRCISRNFVCNGQDDCSDGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCLPAPQINDHSPKYTCSCPSGYNVEENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGINVTTAVSEVSVPPKGTS

110-130 kDa (glycosylation)

Greater than 95% as determined by Tris-Bis PAGE

Lyophilized powder

Lyophilized from 0.22μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.