VSIG4 Protein, Mouse (HEK293, His)

V-set and immunoglobulin domain containing 4 (Vsig4) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. Vsig4 may be a negative regulator of T-cell responses and interleukin-2 production, Vsig4 also mediates clearance of C3b opsonized pathogens by binding C3b. The expression of VSIG4 is restricted to tissue macrophages where Vsig4 inhibits proinflammatory macrophage activation by reprogramming mitochondrial pyruvate metabolism. VSIG4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VSIG4 protein, expressed by HEK293 , with C-6*His labeled tag.

V-set and immunoglobulin domain containing 4 (Vsig4) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. Vsig4 is structurally related to the B7 family of immune regulatory proteins.
Vsig4 may be a negative regulator of T-cell responses, interleukin-2 production and a receptor for the complement component 3 fragments C3b and iC3b. By binding C3b, VSIG4 mediates clearance of C3b opsonized pathogens, such as Listeria monocytogenes and Staphylococcus aureus.
The expression of VSIG4 is restricted to tissue macrophages, including peritoneal macrophages and liverresidential Kupffer cells. Moreover, VSIG4 marks a subset of macrophages that associates with diabetes resistance.
VSIG4 antagonizes activation signals in macrophages by stimulating PI3K/Akt–STAT3 cascades, augmenting expression of pyruvate dehydrogenase kinase-2 (PDK2), and inhibiting pyruvate dehydrogenase (PDH) activity via phosphorylation. Therefore, VSIG4 restricts pyruvate metabolism in the mitochondria during oxidative phosphorylation, resulting in suppression of mtROS secretion and M1 differentiation^[1][2].

Mouse

HEK293

C-6*His

F6TUL9 (H20-P187)

278180  [NCBI]

HPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLP

28-35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.