1. Recombinant Proteins
  2. Others
  3. VSIG4 Protein, Mouse (HEK293, His)

V-set and immunoglobulin domain containing 4 (Vsig4) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. Vsig4 may be a negative regulator of T-cell responses and interleukin-2 production, Vsig4 also mediates clearance of C3b opsonized pathogens by binding C3b. The expression of VSIG4 is restricted to tissue macrophages where Vsig4 inhibits proinflammatory macrophage activation by reprogramming mitochondrial pyruvate metabolism. VSIG4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VSIG4 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

V-set and immunoglobulin domain containing 4 (Vsig4) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. Vsig4 may be a negative regulator of T-cell responses and interleukin-2 production, Vsig4 also mediates clearance of C3b opsonized pathogens by binding C3b. The expression of VSIG4 is restricted to tissue macrophages where Vsig4 inhibits proinflammatory macrophage activation by reprogramming mitochondrial pyruvate metabolism. VSIG4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VSIG4 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

V-set and immunoglobulin domain containing 4 (Vsig4) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. Vsig4 is structurally related to the B7 family of immune regulatory proteins.
Vsig4 may be a negative regulator of T-cell responses, interleukin-2 production and a receptor for the complement component 3 fragments C3b and iC3b. By binding C3b, VSIG4 mediates clearance of C3b opsonized pathogens, such as Listeria monocytogenes and Staphylococcus aureus.
The expression of VSIG4 is restricted to tissue macrophages, including peritoneal macrophages and liverresidential Kupffer cells. Moreover, VSIG4 marks a subset of macrophages that associates with diabetes resistance.
VSIG4 antagonizes activation signals in macrophages by stimulating PI3K/Akt–STAT3 cascades, augmenting expression of pyruvate dehydrogenase kinase-2 (PDK2), and inhibiting pyruvate dehydrogenase (PDH) activity via phosphorylation. Therefore, VSIG4 restricts pyruvate metabolism in the mitochondria during oxidative phosphorylation, resulting in suppression of mtROS secretion and M1 differentiation[1][2].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

F6TUL9 (H20-P187)

Gene ID
Molecular Construction
N-term
VSIG4 (H20-P187)
Accession # F6TUL9
6*His
C-term
Synonyms
Vsig4; V-set and immunoglobulin domain containing 4;
AA Sequence

HPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLP

Molecular Weight

28-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

VSIG4 Protein, Mouse (HEK293, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VSIG4 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71006
Quantity:
MCE Japan Authorized Agent: