angiotensin converting enzyme 2

Pathways Recommended:	Metabolic Enzyme/Protease

By Targets:	Angiotensin-converting Enzyme (ACE) (10) 11β-HSD (3) Autophagy (3) Casein Kinase (3) Caspase (2) CDK (1) Cholinesterase (ChE) (1) Isotope-Labeled Compounds (1) Parasite (3) SARS-CoV (4)
By Research Areas:	Cancer (5) Cardiovascular Disease (5) Infection (5) Inflammation/Immunology (6)

Targets Recommended: Angiotensin-converting Enzyme (ACE) Angiotensin Receptor NEDD8-activating Enzyme E1/E2/E3 Enzyme IRE1 TET Protein

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-P2616A

Mca-YVADAP-Lys(Dnp)-OH TFA	Cholinesterase (ChE) Caspase	Others
Mca-YVADAP-Lys(Dnp)-OH TFA is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

HY-122445

Resorcinolnaphthalein 2 Publications Verification	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Inflammation/Immunology
Resorcinolnaphthalein is a specific angiotensin-converting enzyme 2 (ACE2) enhancer and activates ACE2 activity with an EC₅₀ value of 19.5 μM. Resorcinolnaphthalein can be used for the investigation of hypertension and renal fibrosis .

HY-100450

BML-111	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Inflammation/Immunology Cancer
BML-111, a lipoxin A₄ analog, is a lipoxin A₄ receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of *angiotensinconverting enzyme 2* (ACE2)**. BML-111 has antiangiogenic, antitumor and anti-inflammatory properties .

HY-P4546

Abz-Ser-Pro-3-nitro-Tyr	Angiotensin-converting Enzyme (ACE)	Others
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) .

HY-138067

SSAA09E2	SARS-CoV	Inflammation/Immunology
SSAA09E2 is an inhibitor of SARS-CoV (Severe acute respiratory syndrome-Coronavirus) replication, acting by blocking early interactions of SARS-S with the receptor for SARS-CoV, Angiotensin Converting Enzyme-2 (ACE2) .

HY-P5913

[Tyr6]-Angiotensin II	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
[Tyr6]-Angiotensin II is a peptide fragment , and can bind to the **angiotensin converting enzyme 2** .

HY-156862

(+)-Chloroquine	Others	Others
(+)-Chloroquine is a aminoquinoline drug impairs in vitro the terminal glycosylation of angiotensin-converting enzyme 2 (ACE-2) .

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH	Caspase Angiotensin-converting Enzyme (ACE)	Others
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

HY-W342283

Diminazene	Parasite	Infection Cardiovascular Disease Inflammation/Immunology
Diminazene is an aromatic diamidine compound primarily utilized for the control of trypanosomiasis, a disease caused by trypanosome parasites. Diminazene primarily binds to the kinetoplast DNA (kDNA) of the trypanosomes, interfering with their replication process. Diminazene also presents avenues for novel pharmacological applications, such as acting as an activator of angiotensin-converting enzyme 2 (ACE2), and showing potential in the treatment of hypertension, rheumatoid arthritis, and as an immunomodulator .

HY-12404

Diminazene aceturate 5 Publications Verification Diminazene diaceturate	Parasite Angiotensin-converting Enzyme (ACE)	Infection Inflammation/Immunology
Diminazene aceturate (Diminazene diaceturate) is an anti-trypanosome agent for livestock. The main biochemical mechanism of the trypanocidal actions of Diminazene aceturate is by binding to trypanosomal kinetoplast DNA (kDNA) in a non-intercalative manner through specific interaction with sites rich in adenine-thymine base pairs. Diminazene aceturate is also an angiotensin-converting enzyme 2 (ACE2) activator and has strong and potent anti-inflammatory properties .

HY-15275

BMS-265246	CDK Angiotensin-converting Enzyme (ACE)	Infection Cancer
BMS-265246 is a potent and selective cyclin-dependent kinase CDK1 and CDK2 inhibitor, with IC₅₀ values of 6 and 9 nM, respectively. BMS-265246 inhibits CHI3L1 (chitinase 3-like-1) stimulation of ACE2 (angiotensin converting enzyme 2) and SPP (viral spike protein priming proteases). BMS-265246 can be used for ovarian cancer and COVID-19 research .

HY-12404R

Diminazene aceturate (Standard)	Parasite Angiotensin-converting Enzyme (ACE)	Infection Inflammation/Immunology
Diminazene (aceturate) (Standard) is the analytical standard of Diminazene (aceturate). This product is intended for research and analytical applications. Diminazene aceturate (Diminazene diaceturate) is an anti-trypanosome agent for livestock. The main biochemical mechanism of the trypanocidal actions of Diminazene aceturate is by binding to trypanosomal kinetoplast DNA (kDNA) in a non-intercalative manner through specific interaction with sites rich in adenine-thymine base pairs. Diminazene aceturate is also an angiotensin-converting enzyme 2 (ACE2) activator and has strong and potent anti-inflammatory properties .

HY-14393

Emodin Maximum Cited Publications 21 Publications Verification Frangula emodin	SARS-CoV Casein Kinase Autophagy 11β-HSD	Cancer
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .

HY-14393S

Emodin-d4 Frangula emodin-d₄	Isotope-Labeled Compounds SARS-CoV Casein Kinase Autophagy 11β-HSD	Cancer
Emodin-d₄ is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].

HY-14393R

Emodin (Standard) Frangula emodin (Standard)	SARS-CoV Casein Kinase Autophagy 11β-HSD	Cancer
Emodin (Standard) is the analytical standard of Emodin. This product is intended for research and analytical applications. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .

Cat. No.	Product Name

HY-L052

Anti-COVID-19 Compound Library	1,476 compounds
COVID-19 poses a serious threat to people's health, and it is urgent to develop drugs to treat COVID-19 quickly. The screening of anti-COVID-19 drugs by using the clinical and approved compounds can greatly shorten the research and development cycle. In addition, the virtual screening technology can effectively narrow the scope of screening and improve the screening efficiency in the pre-screening of new drugs. Taking advantage of our virtual screening, we conduct virtual screening of approved compound library and clinical compound library based on the 3CL protease (PDB ID: 6LU7), Spike Glycoprotein (PDB ID: 6VSB), NSP15 (PDB ID: 6VWW), RDRP, PLPro and ACE2 (Angiotensin Converting Enzyme 2) structure. We design a unique collection of 1,476 compounds which may have anti-COVID-19 activity. Anti-COVID-19 Compound Library will be a powerful tool for screening new anti-COVID-19 activity drugs.

Anti-COVID-19 Compound Library

1,476 compounds

COVID-19 poses a serious threat to people's health, and it is urgent to develop drugs to treat COVID-19 quickly. The screening of anti-COVID-19 drugs by using the clinical and approved compounds can greatly shorten the research and development cycle. In addition, the virtual screening technology can effectively narrow the scope of screening and improve the screening efficiency in the pre-screening of new drugs.

Taking advantage of our virtual screening, we conduct virtual screening of approved compound library and clinical compound library based on the 3CL protease (PDB ID: 6LU7), Spike Glycoprotein (PDB ID: 6VSB), NSP15 (PDB ID: 6VWW), RDRP, PLPro and ACE2 (Angiotensin Converting Enzyme 2) structure. We design a unique collection of 1,476 compounds which may have anti-COVID-19 activity. Anti-COVID-19 Compound Library will be a powerful tool for screening new anti-COVID-19 activity drugs.

Cat. No.	Product Name	Type

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH	Chromogenic Substrates
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

Cat. No.	Product Name	Target	Research Area

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-P2616A

Mca-YVADAP-Lys(Dnp)-OH TFA	Cholinesterase (ChE) Caspase	Others
Mca-YVADAP-Lys(Dnp)-OH TFA is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

HY-P4546

Abz-Ser-Pro-3-nitro-Tyr	Angiotensin-converting Enzyme (ACE)	Others
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) .

HY-P5913

[Tyr6]-Angiotensin II	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
[Tyr6]-Angiotensin II is a peptide fragment , and can bind to the **angiotensin converting enzyme 2** .

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH	Caspase Angiotensin-converting Enzyme (ACE)	Others
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-14393

Emodin 20+ Cited Publications Frangula emodin	Structural Classification Classification of Application Fields Polygonaceae Source classification Plants Endogenous metabolite Quinones Human Gut Microbiota Metabolites Microorganisms Rheum palmatum L. Anthraquinones Phenols Polyphenols Disease Research Fields Cancer	SARS-CoV Casein Kinase Autophagy 11β-HSD
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .

HY-14393R

Emodin (Standard) Frangula emodin (Standard)	Quinones Structural Classification Rheum palmatum L. Classification of Application Fields Polygonaceae Source classification Phenols Plants Disease Research Fields Cancer	SARS-CoV Casein Kinase Autophagy 11β-HSD
Emodin (Standard) is the analytical standard of Emodin. This product is intended for research and analytical applications. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .

Recombinant Proteins Recommended:

Angiotensin-Converting Enzyme 2 (ACE2)

Species:	Human (8) Rhesus Macaque (2) Rat (1) Mouse (2)
Tag:	His (9) Avi (3) Fc (6)
Source:	HEK293 (12) Sf9 insect cells (2)

Cat. No.	Compare	Product Name	Species	Source

HY-P7443

	ACE2 Protein, Human (HEK293, mFc) 1 Publications Verification angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (HEK293, mFc) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P73489

	ACE2 Protein, Human (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (HEK293, His) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag.

HY-P72808

	ACE2 Protein, Human (sf9, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	Sf9 insect cells
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (sf9, His) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

HY-P72809

	ACE2 Protein, Rat (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Rat	HEK293
	ACE2 is an important carboxypeptidase in the renin-angiotensin system that complexly regulates cardiovascular homeostasis. It specifically converts angiotensin I to angiotensin 1-9 and angiotensin II to angiotensin 1-7, exerting antihypertrophic and vasodilatory effects. ACE2 Protein, Rat (HEK293, His) is the recombinant rat-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag. The total length of ACE2 Protein, Rat (HEK293, His) is 723 a.a., with molecular weight of 105-120 kDa.

HY-P74434

	ACE2 Protein, Mouse (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Mouse	HEK293

HY-P7441

	ACE2 Protein, Human (HEK293, His, solution) 2 Publications Verification angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (HEK293, His, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P7442

	ACE2 Protein, Human (HEK293, hFc, solution) 1 Publications Verification angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human, (HEK293, Fc, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P70769

	ACE2 Protein, Human (Biotinylated, HEK293, His-Avi) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (Biotinylated, HEK 293, His-Avi) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Human is also an essential regulator of cardiac function and blood pressure control.

HY-P700445

	ACE2 Protein, Paguma larvata (HEK293, hFc) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Others	HEK293
	ACE2 is an important carboxypeptidase in the renin-angiotensin system, converting angiotensin I to anti-hypertrophic angiotensin 1-9 and vasoconstrictor angiotensin II to vasodilator angiotensin 1-7, thereby regulating cardiovascular homeostasis. It can remove the C-terminal residues of vasoactive peptides and cleave a variety of biological peptides. ACE2 Protein, Paguma larvata (HEK293, hFc) is the recombinant ACE2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ACE2 Protein, Paguma larvata (HEK293, hFc) is 723 a.a., with molecular weight of 112.7 kDa.

HY-P700455

	ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

HY-P72810

	ACE2 Protein, Rhesus Macaque (HEK293, Fc) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Rhesus Macaque	HEK293
	ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived ACE2 protein, expressed by HEK293 , with C-hFc labeled tag.

HY-P74433

	ACE2 Protein, Mouse (HEK293, His-Fc) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Mouse	HEK293
	ACE2 protein is an important carboxypeptidase in the renin-angiotensin system, which can regulate blood volume and vascular resistance and maintain cardiovascular homeostasis. It converts angiotensin I to the antihypertrophic angiotensin 1-9 and angiotensin II to the vasodilatory angiotensin 1-7, thereby opposing vasoconstriction. ACE2 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived ACE2 protein, expressed by HEK293 , with C-hFc, C-His, C-8*His labeled tag. The total length of ACE2 Protein, Mouse (HEK293, His-Fc) is 723 a.a., with molecular weight of ~130 kDa.

HY-P7828

	ACE2 Protein, Rhesus macaque (HEK293, His) rRhangiotensin-converting enzyme/ACE-2, His; angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Rhesus Macaque	HEK293
	ACE2 Protein, Rhesus macaque (HEK 293, His) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Rhesus macaque is also an essential regulator of cardiac function and blood pressure control.

HY-P72807

	ACE2 Protein, Human (Biotinylated, sf9, His-Avi) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	Sf9 insect cells
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-Avi, C-His labeled tag.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Product Name	Chemical Structure

HY-14393S

Emodin-d4

Emodin-d₄ is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].

Cat. No.	Compare	Product Name	Application	Reactivity

HY-P80003

	ACE2 Antibody ACE-2; ACE 2; angiotensin converting enzyme 2; ACE related carboxypeptidase; ACEH; angiotensin converting enzyme homolog; angiotensin converting enzyme like protein; angiotensin I converting enzyme (peptidyl dipeptidase A) 2; angiotensin I converting enzyme 2; DKFZP434A014; EC 3.4.17; angiotensin-converting enzyme 2 precursor; ACE2_HUMAN; angiotensin-converting enzyme 2; ACE-related carboxypeptidase; angiotensin-converting enzyme homolog; Metalloprotease MPROT15; Processed angiotensin-converting enzyme 2.	WB, ICC/IF, IHC-P, IP	Human, Mouse, Hamster
	ACE2 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 92 kDa, targeting to ACE2. It can be used for WB,ICC,IHC-P,IP assays with tag free, in the background of Human, Mouse, Hamster.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Host
Reactivity
Application
Dilution Ratio
Molecular Weight
Conjugation
Clonality
Immunogen
Appearance
Isotype
Gene ID
SwissProt ID
Purity
Formulation
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Peptides

Natural
Products

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

angiotensin converting enzyme 2

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Peptides

NaturalProducts

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Natural
Products