bone destruction,

By Targets:	Apoptosis (2) c-Fms (2) c-Kit (1) Caspase (1) CCR (2) ERK (1) Interleukin Related (1) MEK (1) PDGFR (1) RANKL/RANK (2) TNF Receptor (3) VEGFR (1)
By Research Areas:	Cancer (6) Inflammation/Immunology (7) Metabolic Disease (1)

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-106431

Olpadronic acid Olpadronate; OLP	Others	Metabolic Disease Cancer
Olpadronic acid (Olpadronate) is an orally active amino-bisphosphonate and inhibits bone resorption. Olpadronic acid also prevents bone destruction and tumor growth in the skeletal prostate cancer mouse model. Olpadronic acid can be used for research of osteoporosis, malignancies and rheumatoid arthritis .

HY-P2612

WP9QY	TNF Receptor	Others
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)

HY-P2612A

WP9QY TFA	TNF Receptor	Others Cancer
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)

HY-136990

GLPG0259	Others	Cancer
GLPG0259 is a ATP-competitive inhibitor of MAPK-activated protein kinase 5 (MK5) with oral activity. GLPG0259 reduces inflammation and bone destruction in a mouse model of collagen-induced arthritis. GLPG0259 also inhibited the metastasis of prostate cancer (PCa) cells .

HY-P99259

Cabiralizumab FPA 008; Anti-Human CSF1R Recombinant Antibody	c-Fms	Inflammation/Immunology Cancer
Cabiralizumab (FPA 008) is an anti-CSF1R monoclonal antibody (MAb). Cabiralizumab enhances T cell infiltration and antitumor T cell immune responses. Cabiralizumab inhibits the activation of osteoclasts and blocks bone destruction, and can be used in the research of rheumatoid arthritis (RA). Cabiralizumab can combine with Nivolumab (HY-P9903) for lung cancer research .

HY-P4191A

Met-RANTES (human) (acetate)	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-10408

Ki20227 5 Publications Verification	c-Fms VEGFR c-Kit PDGFR	Inflammation/Immunology
Ki20227 is an orally active and highly selective c-Fms tyrosine kinase (CSF1R) inhibitor with IC₅₀s of 2 nM, 12 nM, 451 and 217 nM for CSF1R, VEGFR2 (vascular endothelial growth factor receptor-2), c-Kit (stem cell factor receptor) and PDGFRβ (platelet-derived growth factor receptor β). Ki20227 suppresses osteoclast differentiation and osteolytic bone destruction .

HY-N12740

Napyradiomycin B4	MEK ERK	Others
Napyradiomycin B4 is a Napyradiomycin derivative, which inhibits the RANKL-induced MEK-ERK signaling pathway. Napyradiomycin B4 attenuates osteoclastogenesis and prevents alveolar bone destruction in experimental periodontitis .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-N6973R

Boldine (Standard)	RANKL/RANK	Inflammation/Immunology
Boldine (Standard) is the analytical standard of Boldine. This product is intended for research and analytical applications. Boldine is an aporphine isoquinoline alkaloid extracted from the root of Litsea cubeba and also possesses these properties, including antioxidant, anti-inflammatory and cytoprotective effects. Boldine suppresses osteoclastogenesis, improves bone destruction by down-regulating the OPG/RANKL/RANK signal pathway and may be a potential therapeutic agent for rheumatoid arthritis .

HY-N6973

Boldine 1 Publications Verification	RANKL/RANK Apoptosis	Inflammation/Immunology Cancer
Boldine is an apomorphine isoquinoline alkaloid extracted from the root of the pheasant pepper (Litsea cubeba). Boldine is an oral effective antioxidant, anti-inflammatory, antitumor agent, and can inhibit osteoclast formation. Boldine induces apoptosis of human bladder cancer cells by regulating ERK, AKT and GSK-3β. Boldine ameliorates bone destruction by down-regulating the OPG/RANKL/RANK signaling pathway. It can be used in rheumatoid arthritis research .

HY-P99111

Golimumab CNTO-148	TNF Receptor Apoptosis Interleukin Related Caspase	Inflammation/Immunology Cancer
Golimumab (CNTO-148) is a potent human IgG1 TNFα antagonist monoclonal antibody. Golimumab has anti-inflammation activitity and inhibits IL-6 and IL-1β production. Golimumab acts via targeting and neutralizing TNF to prevent inflammation and destruction of cartilage and bone. Golimumab has the anticancer activity and induces cell apoptosis. Golimumab can be used for rheumatoid arthritis, Crohn's disease and cancer research .

Cat. No.	Product Name	Target	Research Area

HY-P2612

WP9QY	TNF Receptor	Others
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)

HY-P2612A

WP9QY TFA	TNF Receptor	Others Cancer
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)

HY-P4191A

Met-RANTES (human) (acetate)	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

Cat. No.	Product Name	Target	Research Area

HY-P99259

Cabiralizumab FPA 008; Anti-Human CSF1R Recombinant Antibody	c-Fms	Inflammation/Immunology Cancer
Cabiralizumab (FPA 008) is an anti-CSF1R monoclonal antibody (MAb). Cabiralizumab enhances T cell infiltration and antitumor T cell immune responses. Cabiralizumab inhibits the activation of osteoclasts and blocks bone destruction, and can be used in the research of rheumatoid arthritis (RA). Cabiralizumab can combine with Nivolumab (HY-P9903) for lung cancer research .

HY-P99111

Golimumab CNTO-148	TNF Receptor Apoptosis Interleukin Related Caspase	Inflammation/Immunology Cancer
Golimumab (CNTO-148) is a potent human IgG1 TNFα antagonist monoclonal antibody. Golimumab has anti-inflammation activitity and inhibits IL-6 and IL-1β production. Golimumab acts via targeting and neutralizing TNF to prevent inflammation and destruction of cartilage and bone. Golimumab has the anticancer activity and induces cell apoptosis. Golimumab can be used for rheumatoid arthritis, Crohn's disease and cancer research .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-N6973

Boldine 1 Publications Verification	Alkaloids Structural Classification Classification of Application Fields Source classification Phenols Polyphenols Plants Lauraceae Isoquinoline Alkaloids Inflammation/Immunology Disease Research Fields Litsea cubeba (Lour.) Pers.	RANKL/RANK Apoptosis
Boldine is an apomorphine isoquinoline alkaloid extracted from the root of the pheasant pepper (Litsea cubeba). Boldine is an oral effective antioxidant, anti-inflammatory, antitumor agent, and can inhibit osteoclast formation. Boldine induces apoptosis of human bladder cancer cells by regulating ERK, AKT and GSK-3β. Boldine ameliorates bone destruction by down-regulating the OPG/RANKL/RANK signaling pathway. It can be used in rheumatoid arthritis research .

HY-N12740

Napyradiomycin B4	Structural Classification Natural Products Microorganisms Source classification	MEK ERK
Napyradiomycin B4 is a Napyradiomycin derivative, which inhibits the RANKL-induced MEK-ERK signaling pathway. Napyradiomycin B4 attenuates osteoclastogenesis and prevents alveolar bone destruction in experimental periodontitis .

HY-N6973R

Boldine (Standard)	Structural Classification Alkaloids Classification of Application Fields Source classification Phenols Plants Lauraceae Inflammation/Immunology Disease Research Fields Litsea cubeba (Lour.) Pers.	RANKL/RANK
Boldine (Standard) is the analytical standard of Boldine. This product is intended for research and analytical applications. Boldine is an aporphine isoquinoline alkaloid extracted from the root of Litsea cubeba and also possesses these properties, including antioxidant, anti-inflammatory and cytoprotective effects. Boldine suppresses osteoclastogenesis, improves bone destruction by down-regulating the OPG/RANKL/RANK signal pathway and may be a potential therapeutic agent for rheumatoid arthritis .

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inhibitors & Agonists

Peptides

Inhibitory Antibodies

Natural
Products

Name
Email *

	Sorry, but the email address you supplied was invalid.

bone destruction,

Inhibitors & Agonists

Peptides

Inhibitory Antibodies

NaturalProducts

Natural
Products