Teduglutide TFA  (Synonyms: ALX-0600 TFA)

Teduglutide TFA is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide TFA can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 and intestinal FXR signaling in human hepatic stellate cells, thereby improving liver inflammation and fibrosis in mice with sclerosing cholangitis. Teduglutide TFA can alleviate intestinal dysfunction in mice, improve lung injury, alleviate obesity related neuroinflammation and cell apoptosis^[1][2][3][4].

Teduglutide (2.5 μM, 36 h) TFA can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 in human hepatic stellate cells^[4].
Teduglutide TFA can increase the proliferation of all intestinal segment epithelial cells and reduce cell apoptosis in the short intestine newborn piglet model^[5].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Teduglutide (0.1 mg/kg; twice daily; 2 weeks; s.c.) TFA can alleviate intestinal dysfunction and nucleotide oligomeric domain 2 (Nod2) dysfunction induced intestinal failure in cecectomy mice^[1].
Teduglutide (200 μg/kg; twice daily; 10 days; s.c.) TFA has anti apoptotic and antioxidant activities in mice with lung injury^[2].
Teduglutide (5 μg; once daily; 4 weeks; i.p.) TFA can improve obesity related neuroinflammation, central stress, and cell apoptosis in mice fed a high-fat diet^[3].
Teduglutide (0.05 mg/kg; once daily; 4 weeks; i.p.) TFA improves liver inflammation and fibrosis in a Mdr2 mouse model of sclerosing cholangitis by activating NR4a1/nur77 in hepatic stellate cells and intestinal FXR signaling^[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

3752.13 (free acid)

C₁₆₄H₂₅₂N₄₄O₅₅S.xC₂HF₃O₂

HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Reiner J, et al. Teduglutide Promotes Epithelial Tight Junction Pore Function in Murine Short Bowel Syndrome to Alleviate Intestinal Insufficiency. Dig Dis Sci. 2020 Dec;65(12):3521-3537.  [Content Brief]

  [2]. Arda-Pirincci P, et al. Teduglutide, a glucagon-like peptide 2 analogue: a novel protective agent with anti-apoptotic and anti-oxidant properties in mice with lung injury. Peptides. 2012 Dec;38(2):238-47.  [Content Brief]

  [3]. Nuzzo D, et al. Glucagon-like peptide-2 reduces the obesity-associated inflammation in the brain. Neurobiol Dis. 2019 Jan;121:296-304.  [Content Brief]

  [4]. Fuchs CD, et al. GLP-2 Improves Hepatic Inflammation and Fibrosis in Mdr2-/- Mice Via Activation of NR4a1/Nur77 in Hepatic Stellate Cells and Intestinal FXR Signaling. Cell Mol Gastroenterol Hepatol. 2023;16(5):847-856.  [Content Brief]

  [5]. Naberhuis JK, et al. Teduglutide-Stimulated Intestinal Adaptation Is Complemented and Synergistically Enhanced by Partial Enteral Nutrition in a Neonatal Piglet Model of Short Bowel Syndrome. JPEN J Parenter Enteral Nutr. 2017 Jul;41(5):853-865.  [Content Brief]