1. Vitamin D Related/Nuclear Receptor Metabolic Enzyme/Protease
  2. Nuclear Hormone Receptor 4A/NR4A FXR
  3. Teduglutide

Teduglutide (ALX-0600) is an analog of human glucagon like peptide-2 (GLP-2). Teduglutide can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 and intestinal FXR signaling in human hepatic stellate cells, thereby improving liver inflammation and fibrosis in mice with sclerosing cholangitis. Teduglutide can alleviate intestinal dysfunction in mice, improve lung injury, alleviate obesity related neuroinflammation and cell apoptosis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Teduglutide Chemical Structure

Teduglutide Chemical Structure

CAS No. : 197922-42-2

Size Price Stock Quantity
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Teduglutide:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Teduglutide

View All Nuclear Hormone Receptor 4A/NR4A Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Teduglutide (ALX-0600) is an analog of human glucagon like peptide-2 (GLP-2). Teduglutide can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 and intestinal FXR signaling in human hepatic stellate cells, thereby improving liver inflammation and fibrosis in mice with sclerosing cholangitis. Teduglutide can alleviate intestinal dysfunction in mice, improve lung injury, alleviate obesity related neuroinflammation and cell apoptosis[1][2][3][4].

IC50 & Target

Nur77/NR4A1

 

In Vitro

Teduglutide (2.5 μM, 36 h) can activate the expression of nuclear receptor subfamily 4 group a member 1 (NR4a1)/nur77 in human hepatic stellate cells[4].
Teduglutide can increase the proliferation of all intestinal segment epithelial cells and reduce cell apoptosis in the short intestine newborn piglet model[5].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Real Time qPCR[4].

Cell Line: Human Hepatic Stellate Cells (HSC)
Concentration: 2.5 μM
Incubation Time: 36 h
Result: Increased transcription levels of NR4a1/Nur77.
In Vivo

Teduglutide (0.1 mg/kg; twice daily; 2 weeks; s.c.) can alleviate intestinal dysfunction and nucleotide oligomeric domain 2 (Nod2) dysfunction induced intestinal failure in cecectomy mice[1].
Teduglutide (200 μg/kg; twice daily; 10 days; s.c.) has anti apoptotic and antioxidant activities in mice with lung injury[2].
Teduglutide (5 μg; once daily; 4 weeks; i.p.) can improve obesity related neuroinflammation, central stress, and cell apoptosis in mice fed a high-fat diet[3].
Teduglutide (0.05 mg/kg; once daily; 4 weeks; i.p.) improves liver inflammation and fibrosis in a Mdr2 mouse model of sclerosing cholangitis by activating NR4a1/nur77 in hepatic stellate cells and intestinal FXR signaling[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Adult male mice undergoing 12-cm ileocecal and cecal resection (ICR)[1].
Dosage: 0.1 mg/kg
Administration: Subcutaneous injection (s.c.); twice daily; 2 weeks
Result: Resulted in a decrease in plasma aldosterone concentration, a decrease in fecal water content, and a decrease in fecal sodium loss.
Animal Model: A mouse model with lung injury induced by tumor necrosis factor-alpha (TNF-α) and actinomycin D (Act D)[2].
Dosage: 200 μg/kg
Administration: Subcutaneous injection (s.c.); twice daily; 10 days
Result: Attenuated structural damage, cell apoptosis, and oxidative stress by reducing lipid peroxidation in mice receiving TNF - α/AtD.
Animal Model: Mice fed a high-fat diet (HFD)[3].
Dosage: 5 μg
Administration: Intraperitoneal injection (i.p.); once daily; 4 weeks
Result: Reduced the expression of HFD induced pro-inflammatory mediators (NF kB, IL-8, TNF - α, IL-1 β, and IL-6), glial fibrillary acidic protein (GFAP), glial proliferation and neurodegeneration index, stress marker proteins (p-ERK, Hsp60, and i-NOS), and amyloid beta precursor protein (APP).
Animal Model: The Mdr2/Abcb4 mouse model of sclerosing cholangitis displaying hepatic inflammation and fibrosis[4].
Dosage: 0.05 mg/kg
Administration: Intraperitoneal injection (i.p.); once daily; 4 weeks
Result: Resulted in an increase in intrahepatic level of muricholic acids and serum Fgf15 level, as well as a decrease in mRNA levels of Cyp7a1 and FXR.
Clinical Trial
Molecular Weight

3752.13

Formula

C164H252N44O55S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence Shortening

HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

DMSO : 50 mg/mL (13.33 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : 22.22 mg/mL (5.92 mM; ultrasonic and adjust pH to 2 with HCl)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2665 mL 1.3326 mL 2.6652 mL
5 mM 0.0533 mL 0.2665 mL 0.5330 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.94%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O / DMSO 1 mM 0.2665 mL 1.3326 mL 2.6652 mL 6.6629 mL
5 mM 0.0533 mL 0.2665 mL 0.5330 mL 1.3326 mL
DMSO 10 mM 0.0267 mL 0.1333 mL 0.2665 mL 0.6663 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Teduglutide
Cat. No.:
HY-P1624
Quantity:
MCE Japan Authorized Agent: