2. Protein Tyrosine Kinase/RTK
  3. FGFR
  4. Vosoritide acetate

Vosoritide acetate  (Synonyms: BMN 111 acetate)

Cat. No.: HY-P3503A Purity: 99.72%
SDS COA Handling Instructions

Molarity Calculator

Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Vosoritide acetate Chemical Structure

Vosoritide acetate Chemical Structure

Size Price Stock Quantity
1 mg USD 160 In-stock
5 mg USD 400 In-stock
10 mg USD 640 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Vosoritide acetate:

Vosoritide acetate Related Antibodies

Top Publications Citing Use of Products

View All FGFR Isoform Specific Products:

View All Isoforms
FGFR FGFR1 FGFR2 FGFR3 FGFR4 FGF21

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth[1].

In Vitro

Vosoritide (0.1 μM; 1 h) acetate decreases NPR2 phosphorylation in chondrocytes[2].
Vosoritide (0.1 μM; 6 d) acetate improves chondrocyte differentiation and increases the proliferative growth plate area of cultured Fgfr3Y367C/+ femurs[2].
Vosoritide (10 μM; overnight) acetate reduces ERK1/2 activation in ACH growth-plate chondrocytes[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Vosoritide acetate Related Antibodies

Western Blot Analysis[2]

Cell Line: Chondrocyte cultures
Concentration: 0.1 μM
Incubation Time: 1 hour
Result: Led to reduction in NPR2 phosphorylation.

Western Blot Analysis[3]

Cell Line: Chondrocyte
Concentration: 10 μM
Incubation Time: Overnight
Result: Prevented FGF-mediated increase in ERK1/2 phosphorylation.
In Vivo

Vosoritide (subcutaneous injection; 800 μg/kg; once daily; 20 d) acetate treatment leads to improvement in skeletal parameters in Fgfr3 gain-of-function mutation mouse[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Fgfr3Y367C/+ mice[3]
Dosage: 800 μg/kg
Administration: Subcutaneous injection; 800 μg/kg; once daily; 20 days
Result: Observed phenotypic changes including flattening of the skull, elongation of the snout, improvement of the anterior crossbite, larger paws and digits, and longer and straightened tibias and femurs.
Clinical Trial
Molecular Weight

4162.78

Formula

C176H290N56O51S3.C2H4O2
Appearance

Solid

Color

White to off-white

Sequence

Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys23-Cys39)
Sequence Shortening

PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys23-Cys39)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

H2O : ≥ 100 mg/mL (24.02 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2402 mL 1.2011 mL 2.4022 mL
5 mM 0.0480 mL 0.2402 mL 0.4804 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.72%

SDS (252 KB)

COA (249 KB) RP-HPLC (112 KB) MS (213 KB) Elemental Analysis Report (106 KB)

Handling Instructions (2659 KB)
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2402 mL 1.2011 mL 2.4022 mL 6.0056 mL
5 mM 0.0480 mL 0.2402 mL 0.4804 mL 1.2011 mL
10 mM 0.0240 mL 0.1201 mL 0.2402 mL 0.6006 mL
15 mM 0.0160 mL 0.0801 mL 0.1601 mL 0.4004 mL
20 mM 0.0120 mL 0.0601 mL 0.1201 mL 0.3003 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Vosoritide acetate Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

VosoritideBMN 111BMN111BMN-111FGFRFibroblast growth factor receptorNPR2proliferationdifferentiationbone growthInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Vosoritide acetate
Cat. No.:
HY-P3503A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.