1. Protein Tyrosine Kinase/RTK
  2. FGFR
  3. Vosoritide

Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Vosoritide Chemical Structure

Vosoritide Chemical Structure

CAS No. : 1480724-61-5

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Vosoritide:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research[1][2][3].

In Vitro

Vosoritide (0.1 μM; 1 h) decreases NPR2 phosphorylation in chondrocytes[2].
Vosoritide (0.1 μM; 6 d) improves chondrocyte differentiation and increases the proliferative growth plate area of cultured Fgfr3Y367C/+ femurs[2].
Vosoritide (10 μM; overnight) reduces ERK1/2 activation in ACH growth-plate chondrocytes[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis[2]

Cell Line: Chondrocyte cultures
Concentration: 0.1 μM
Incubation Time: 1 hour
Result: Led to reduction in NPR2 phosphorylation.

Western Blot Analysis[3]

Cell Line: Chondrocyte
Concentration: 10 μM
Incubation Time: Overnight
Result: Prevented FGF-mediated increase in ERK1/2 phosphorylation.
In Vivo

Vosoritide (subcutaneous injection; 800 μg/kg; once daily; 20 d) treatment leads to improvement in skeletal parameters in Fgfr3 gain-of-function mutation mouse[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Fgfr3Y367C/+ mice[3]
Dosage: 800 μg/kg
Administration: Subcutaneous injection; 800 μg/kg; once daily; 20 days
Result: Observed phenotypic changes including flattening of the skull, elongation of the snout, improvement of the anterior crossbite, larger paws and digits, and longer and straightened tibias and femurs.
Clinical Trial
Molecular Weight

4102.73

Formula

C176H290N56O51S3

CAS No.
Sequence

Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys23-Cys39)

Sequence Shortening

PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys23-Cys39)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Vosoritide
Cat. No.:
HY-P3503
Quantity:
MCE Japan Authorized Agent: